SitesBLAST
Comparing AO356_26510 FitnessBrowser__pseudo5_N2C3_1:AO356_26510 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 13 hits to proteins with known functional sites (download)
P78753 Probable asparagine synthetase [glutamine-hydrolyzing]; Glutamine-dependent asparagine synthetase; EC 6.3.5.4 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
28% identity, 66% coverage: 1:418/631 of query aligns to 1:415/557 of P78753
- S391 (≠ T394) modified: Phosphoserine
Sites not aligning to the query:
- 489 modified: Phosphoserine
1ct9A Crystal structure of asparagine synthetase b from escherichia coli (see paper)
28% identity, 56% coverage: 26:376/631 of query aligns to 27:343/497 of 1ct9A
- active site: L50 (= L51), N74 (= N73), G75 (= G74), T305 (≠ N340), R308 (≠ G343), E332 (≠ D365)
- binding adenosine monophosphate: L232 (≠ Y263), L233 (= L264), S234 (= S265), S239 (= S270), A255 (≠ T289), V256 (= V290), D263 (= D298), M316 (≠ L349), S330 (≠ A363), G331 (= G364), E332 (≠ D365)
- binding glutamine: R49 (= R50), L50 (= L51), I52 (≠ M53), V53 (= V54), N74 (= N73), G75 (= G74), E76 (= E75), D98 (= D98)
Sites not aligning to the query:
P22106 Asparagine synthetase B [glutamine-hydrolyzing]; AS-B; EC 6.3.5.4 from Escherichia coli (strain K12) (see 2 papers)
27% identity, 56% coverage: 26:376/631 of query aligns to 28:360/554 of P22106
- H30 (= H28) mutation to A: 4,5-fold decrease in glutamine affinity.
- D34 (= D32) mutation D->N,E: Little effect on the kinetic properties.
- H81 (≠ Y79) mutation to A: 5-fold decrease in glutamine affinity.
- A105 (≠ H104) mutation to H: Little effect on the kinetic properties.
- E349 (≠ D365) mutation E->A,Q: Loss of glutamine- and ammonia-dependent synthetase activity, but still exhibits glutaminase activity.; mutation to D: 5-fold increase in affinity for aspartate when assaying both the glutamine- and ammonia-dependent synthetase reactions, and 2-fold decrease in kcat for these reactions. Modifies the product glutamate/asparagine stoichiometry.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 mutation C->A,S: Loss of glutamine-dependent activity but no effect on ammonia-dependent asparagine synthetase activity.
P08243 Asparagine synthetase [glutamine-hydrolyzing]; Cell cycle control protein TS11; Glutamine-dependent asparagine synthetase; EC 6.3.5.4 from Homo sapiens (Human) (see 7 papers)
27% identity, 55% coverage: 28:376/631 of query aligns to 26:376/561 of P08243
- V210 (≠ A226) to E: in dbSNP:rs1049674
- F362 (≠ L362) to V: in ASNSD; dramatic reduction in protein abundance; dbSNP:rs398122973
Sites not aligning to the query:
- 2 active site, For GATase activity; C→A: Loss of the glutamine-dependent asparagine synthetase activity, while the ammonia-dependent activity remained unaffected.
- 6 A → E: in ASNSD; dramatic reduction in protein abundance; dbSNP:rs398122975
- 550 R → C: in ASNSD; increases level of protein abundance; dbSNP:rs398122974
6gq3A Human asparagine synthetase (asns) in complex with 6-diazo-5-oxo-l- norleucine (don) at 1.85 a resolution (see paper)
27% identity, 55% coverage: 28:376/631 of query aligns to 25:363/509 of 6gq3A
- active site: L49 (= L51), N74 (= N73), G75 (= G74), T324 (≠ N340), R327 (≠ G343)
- binding 5-oxo-l-norleucine: R48 (= R50), V51 (≠ M53), V52 (= V54), Y73 (≠ V72), N74 (= N73), G75 (= G74), E76 (= E75), V95 (≠ S97), D96 (= D98)
Sites not aligning to the query:
Q9XB61 Carbapenam-3-carboxylate synthase; Carbapenam-3-carboxylate ligase; EC 6.3.3.6 from Pectobacterium carotovorum subsp. carotovorum (Erwinia carotovora subsp. carotovora) (see 3 papers)
24% identity, 44% coverage: 97:373/631 of query aligns to 80:353/503 of Q9XB61
- 244:251 (vs. 263:270, 75% identical) binding
- I270 (≠ V290) binding
- GYGSD 344:348 (≠ GDGAD 364:368) binding
- Y345 (≠ D365) mutation to A: Loss of activity.; mutation to F: Reduces catalytic efficiency.
- G346 (= G366) binding
Sites not aligning to the query:
- 371 binding
- 374 binding
- 380 E→A: Loss of activity.; E→D: Reduces catalytic efficiency.; E→Q: Reduces catalytic efficiency.
- 421 binding
- 443 mutation K->A,M: Loss of activity.
- 444:446 binding
1q19A Carbapenam synthetase (see paper)
24% identity, 44% coverage: 97:373/631 of query aligns to 79:352/500 of 1q19A
- active site: L318 (vs. gap), E321 (vs. gap), Y344 (≠ D365)
- binding diphosphomethylphosphonic acid adenosyl ester: P243 (≠ Y263), L244 (= L264), S245 (= S265), D249 (= D269), S250 (= S270), S268 (≠ T289), I269 (≠ V290), T342 (≠ A363), G343 (= G364), D347 (= D368)
- binding (2s,5s)-5-carboxymethylproline: Y344 (≠ D365), G345 (= G366), L348 (≠ E369)
Sites not aligning to the query:
Q9STG9 Amidophosphoribosyltransferase 2, chloroplastic; AtATase2; AtPURF2; PRPP2; Glutamine phosphoribosylpyrophosphate amidotransferase 2; AtGPRAT2; Protein CHLOROPLAST IMPORT APPARATUS 1; Protein DIFFERENTIAL DEVELOPMENT OF VASCULAR ASSOCIATED CELLS; EC 2.4.2.14 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
27% identity, 43% coverage: 12:281/631 of query aligns to 117:383/561 of Q9STG9
- H187 (≠ V72) mutation to T: In cia1-2; small plants with white leaves showing an irregular mosaic of green sectors.
- R264 (≠ K143) mutation to K: Strong resistance to the bleaching herbicides DAS073 and DAS734.
- P265 (= P144) mutation to S: Low resistance to the bleaching herbicides DAS073 and DAS734; when associated with F-494.
- G371 (≠ A271) mutation to S: Low resistance to the bleaching herbicides DAS073 and DAS734.
Sites not aligning to the query:
- 476 P→S: Resistance to the bleaching herbicides DAS073 and DAS734.
- 494 Y→F: Low resistance to the bleaching herbicides DAS073 and DAS734; when associated with S-265.
6lbpA Structure of the glutamine phosphoribosylpyrophosphate amidotransferase from arabidopsis thaliana (see paper)
27% identity, 43% coverage: 12:281/631 of query aligns to 31:297/460 of 6lbpA
Sites not aligning to the query:
1mbzA Beta-lactam synthetase with trapped intermediate (see paper)
26% identity, 48% coverage: 71:373/631 of query aligns to 67:345/496 of 1mbzA
- active site: A69 (≠ N73), G70 (= G74), D311 (≠ N340), Y337 (≠ D365)
- binding arginine-n-methylcarbonyl phosphoric acid 5'-adenosine ester: V236 (≠ Y263), L237 (= L264), S238 (= S265), S243 (= S270), S261 (≠ D291), M262 (≠ F292), Y315 (≠ A344), L319 (≠ I348), G336 (= G364), Y337 (≠ D365), G338 (= G366), D340 (= D368), I341 (≠ E369)
- binding magnesium ion: D242 (= D269), D340 (= D368)
- binding pyrophosphate 2-: S238 (= S265), G240 (= G267), D242 (= D269), S243 (= S270), D340 (= D368)
Sites not aligning to the query:
1mb9A Beta-lactam synthetase complexed with atp (see paper)
26% identity, 48% coverage: 71:373/631 of query aligns to 68:344/485 of 1mb9A
- active site: A70 (≠ N73), G71 (= G74), D310 (≠ N340), Y336 (≠ D365)
- binding adenosine monophosphate: V235 (≠ Y263), L236 (= L264), S242 (= S270), S260 (≠ D291), M261 (≠ F292), Y314 (≠ A344), L318 (≠ I348), G335 (= G364), Y336 (≠ D365)
- binding adenosine-5'-triphosphate: V235 (≠ Y263), L236 (= L264), S237 (= S265), G239 (= G267), D241 (= D269), S242 (= S270), S260 (≠ D291), M261 (≠ F292), L318 (≠ I348), G335 (= G364), D339 (= D368)
- binding magnesium ion: D241 (= D269), D339 (= D368)
- binding pyrophosphate 2-: S237 (= S265), G239 (= G267), D241 (= D269), S242 (= S270), D339 (= D368)
Sites not aligning to the query:
1jgtB Crystal structure of beta-lactam synthetase (see paper)
26% identity, 48% coverage: 71:373/631 of query aligns to 71:353/500 of 1jgtB
- active site: A73 (≠ N73), G74 (= G74), D319 (≠ N340), Y345 (≠ D365)
- binding diphosphomethylphosphonic acid adenosyl ester: V244 (≠ Y263), L245 (= L264), S246 (= S265), G248 (= G267), I249 (≠ V268), D250 (= D269), S251 (= S270), S269 (≠ D291), M270 (≠ F292), L327 (≠ I348), G344 (= G364), Y345 (≠ D365), D348 (= D368)
- binding n2-(carboxyethyl)-l-arginine: Y323 (≠ A344), Y345 (≠ D365), G346 (= G366), D348 (= D368), I349 (≠ E369)
- binding magnesium ion: D250 (= D269), D348 (= D368)
Sites not aligning to the query:
1mc1A Beta-lactam synthetase with product (dgpc), amp and ppi (see paper)
25% identity, 48% coverage: 71:373/631 of query aligns to 63:340/491 of 1mc1A
- active site: A65 (≠ N73), G66 (= G74), D306 (≠ N340), Y332 (≠ D365)
- binding adenosine monophosphate: V231 (≠ Y263), S233 (= S265), S238 (= S270), S256 (≠ D291), M257 (≠ F292), G331 (= G364)
- binding magnesium ion: D237 (= D269), D335 (= D368)
- binding deoxyguanidinoproclavaminic acid: Y310 (≠ A344), Y332 (≠ D365), G333 (= G366), I336 (≠ E369)
- binding pyrophosphate 2-: S233 (= S265), G235 (= G267), D237 (= D269), S238 (= S270), D335 (= D368)
Sites not aligning to the query:
Query Sequence
>AO356_26510 FitnessBrowser__pseudo5_N2C3_1:AO356_26510
MCGFVVACHHQAPVPTVTLDAALDTLRHRGPDGRASWLSADGLCGIGFHRLAMVGAREQT
QPFHTDDVHVVVNGEIYQYAAQRQKLEAAGACFATDSDCEVVAHGYLQLGIDYVRELNGE
FAGVIWDARRRKLFAIRDRWGVKPLFYRLSDQGIHLASEIKALIALGAQPRWDHAALFQH
FFASIGPAQTLFEGIHQVPPGHVLEWSTQGYGVTPLLSAVDEAHDAARQHLASAPREWMP
RLVDGLRHAVQDRFQGDGPVACYLSGGVDSATVAALAARHGREGLSAFTVDFGAGTDDAT
QAAGIAASLGLRHEVVPVSEAQLVDHFADAVRHAETIGFNTIGAARWILGRVLASSGYKA
VLAGDGADELFAGYSFSSVERLCARSHNHARLMTQVLEGGRQGLAAELGQPLPLFDMDPD
RFGGQVPYLLASWNYQRSGLRPLLRTQFLEAFRHFNPYEVLMQQTGASAASGLRRSLHLW
QKSMFANHILVSERFDMAHGIETRYPFLDNRVTAVAAMLPDEWLVEGAENKRFLREAVAA
LTPEAARCAAKRPFEAPAVFAQPGDGPFRRYLREVLHDSSVKHSGIFDVQELLRLEARLP
SLSGKMAQRVDSLLTMALSFFVLQQCFAVTE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory