SitesBLAST
Comparing AO356_26660 FitnessBrowser__pseudo5_N2C3_1:AO356_26660 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7dqxE Crystal structure of xanthine dehydrogenase family protein
38% identity, 97% coverage: 1:260/268 of query aligns to 1:275/293 of 7dqxE
- binding flavin-adenine dinucleotide: K29 (≠ R29), I30 (= I30), I31 (= I31), G33 (= G33), G34 (= G34), Q35 (= Q35), S36 (= S36), L37 (= L37), H78 (≠ Q78), I101 (= I101), A102 (≠ G102), I106 (≠ T106), G110 (= G110), T111 (= T111), G113 (≠ C113), G114 (= G114), S115 (= S115), A117 (= A117), A123 (= A123), E124 (= E124), I167 (≠ V167), Y193 (≠ F193)
1t3qC Crystal structure of quinoline 2-oxidoreductase from pseudomonas putida 86 (see paper)
40% identity, 75% coverage: 1:202/268 of query aligns to 1:199/285 of 1t3qC
- binding flavin-adenine dinucleotide: I29 (= I30), A31 (= A32), G32 (= G33), G33 (= G34), Q34 (= Q35), S35 (= S36), L36 (= L37), V100 (≠ I101), A101 (≠ G102), V105 (≠ T106), T110 (= T111), G113 (= G114), S114 (= S115), A116 (= A117), A122 (= A123), E123 (= E124), L166 (≠ V167), Y190 (≠ F193)
4zohB Crystal structure of glyceraldehyde oxidoreductase (see paper)
30% identity, 99% coverage: 1:265/268 of query aligns to 1:269/274 of 4zohB
- active site: Y256 (= Y252)
- binding flavin-adenine dinucleotide: R28 (= R29), P29 (≠ I30), A31 (= A32), G32 (= G33), G33 (= G34), H34 (≠ Q35), S35 (= S36), L36 (= L37), H77 (≠ Q78), I95 (= I101), G96 (= G102), V100 (≠ T106), T105 (= T111), G108 (= G114), S109 (= S115), S111 (≠ A117), A117 (= A123), D118 (≠ E124), L160 (= L166), V161 (= V167), D185 (= D192), F186 (= F193)
1ffuC Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor (see paper)
34% identity, 74% coverage: 1:199/268 of query aligns to 1:199/287 of 1ffuC
- binding flavin-adenine dinucleotide: K29 (≠ R29), L30 (≠ I30), A32 (= A32), G33 (= G33), G34 (= G34), H35 (≠ Q35), S36 (= S36), L37 (= L37), I54 (= I54), I101 (= I101), A102 (≠ G102), G110 (= G110), T111 (= T111), G114 (= G114), D115 (≠ S115), A117 (= A117), N123 (≠ A123), D124 (≠ E124), L161 (≠ K161), V166 (≠ L166), M167 (≠ V167), W193 (≠ F193)
1n5wC Crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form (see paper)
32% identity, 72% coverage: 1:193/268 of query aligns to 1:193/287 of 1n5wC
P19920 Carbon monoxide dehydrogenase medium chain; CO dehydrogenase subunit M; CO-DH M; EC 1.2.5.3 from Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5) (Oligotropha carboxidovorans) (see 2 papers)
32% identity, 72% coverage: 1:193/268 of query aligns to 1:193/288 of P19920
3hrdG Crystal structure of nicotinate dehydrogenase (see paper)
31% identity, 62% coverage: 6:170/268 of query aligns to 4:172/292 of 3hrdG
- binding flavin-adenine dinucleotide: I29 (= I30), A31 (= A32), G32 (= G33), G33 (= G34), T34 (≠ Q35), D35 (≠ S36), F77 (≠ Q78), V100 (≠ I101), G101 (= G102), I105 (≠ T106), T110 (= T111), G113 (= G114), N114 (≠ S115), S116 (≠ A117), T117 (≠ H118), G122 (≠ A123), D123 (≠ E124), I168 (≠ L166), M169 (≠ V167)
Q0QLF4 Nicotinate dehydrogenase FAD-subunit; NDH; Nicotinic acid hydroxylase FAD-subunit; NAH; EC 1.17.1.5 from Eubacterium barkeri (Clostridium barkeri) (see paper)
31% identity, 62% coverage: 6:170/268 of query aligns to 4:172/296 of Q0QLF4
- 29:36 (vs. 30:37, 75% identical) binding
- G101 (= G102) binding
- TIGGN 110:114 (≠ TVCGS 111:115) binding
- D123 (≠ E124) binding
- R160 (≠ K161) binding
- M169 (≠ V167) binding
Sites not aligning to the query:
2w54A Crystal structure of xanthine dehydrogenase from rhodobacter capsulatus in complex with bound inhibitor pterin-6-aldehyde (see paper)
26% identity, 92% coverage: 7:253/268 of query aligns to 156:423/450 of 2w54A
- binding flavin-adenine dinucleotide: L189 (≠ I30), A191 (= A32), G192 (= G33), G193 (= G34), T194 (≠ Q35), D195 (≠ S36), V196 (≠ L37), W199 (≠ V40), L213 (≠ I54), F258 (≠ I101), A259 (≠ G102), A267 (≠ G110), T268 (= T111), G271 (= G114), N272 (≠ S115), A274 (= A117), N275 (≠ H118), G280 (≠ A123), D281 (≠ E124), R318 (≠ K161), V324 (= V167), Q347 (≠ R184)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 42
- binding fe2/s2 (inorganic) cluster: 38, 39, 40, 42, 44, 45, 47, 63, 103, 104, 106, 134, 135, 136
- binding {[(5aR,8R,9aR)-2-amino-4-oxo-6,7-di(sulfanyl-kappaS)-3,5,5a,8,9a,10-hexahydro-4H-pyrano[3,2-g]pteridin-8-yl]methyl dihydrogenato(2-) phosphate}(hydroxy)oxo(thioxo)molybdenum: 102, 136
1jroA Crystal structure of xanthine dehydrogenase from rhodobacter capsulatus (see paper)
26% identity, 92% coverage: 7:253/268 of query aligns to 156:423/450 of 1jroA
- binding flavin-adenine dinucleotide: L189 (≠ I30), A191 (= A32), G192 (= G33), G193 (= G34), T194 (≠ Q35), D195 (≠ S36), V196 (≠ L37), F258 (≠ I101), A259 (≠ G102), T268 (= T111), G271 (= G114), N272 (≠ S115), A274 (= A117), G280 (≠ A123), D281 (≠ E124), R318 (≠ K161), V324 (= V167)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 42, 43
- binding fe2/s2 (inorganic) cluster: 37, 38, 39, 40, 42, 44, 45, 47, 63, 103, 106, 134, 136
Q8GUQ8 Xanthine dehydrogenase 1; AtXDH1; EC 1.17.1.4 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
24% identity, 68% coverage: 15:197/268 of query aligns to 271:463/1361 of Q8GUQ8
- W364 (= W100) mutation to A: Decreases activity 8-fold.
- Y421 (≠ I156) mutation to A: Decreases activity 4-fold.
Sites not aligning to the query:
- 831 E→A: Loss of activity.
- 909 R→A: Decreases activity 12-fold.
- 1297 E→A: Decreases activity 40-fold.
P47989 Xanthine dehydrogenase/oxidase; EC 1.17.1.4; EC 1.17.3.2 from Homo sapiens (Human) (see 4 papers)
22% identity, 78% coverage: 8:217/268 of query aligns to 236:462/1333 of P47989
- 257:264 (vs. 30:37, 13% identical) binding
- F337 (≠ I101) binding
- SVGGN 347:351 (≠ TVCGS 111:115) binding
- D360 (≠ E124) binding
- K395 (≠ T158) to M: in dbSNP:rs34929837
- K422 (≠ R184) binding
Sites not aligning to the query:
- 133 E → K: in dbSNP:rs45447191
- 172 G → R: in dbSNP:rs45523133
- 235 T → M: in dbSNP:rs45469499
- 509 modified: Disulfide link with 1318, In oxidase form
- 536 modified: Disulfide link with 993, In oxidase form
- 555 P → S: in dbSNP:rs45577338
- 584 D → A: in dbSNP:rs45491693
- 607 R → Q: in dbSNP:rs45442092
- 617 K → N: in dbSNP:rs45442398
- 623 T → I: in dbSNP:rs45448694
- 646 I → V: in dbSNP:rs17323225
- 703 I → V: in dbSNP:rs17011368
- 763 L → F: in a breast cancer sample; somatic mutation
- 791 R → G: in a breast cancer sample; somatic mutation; dbSNP:rs775646772
- 910 T → M: in dbSNP:rs669884
- 993 modified: Disulfide link with 536, In oxidase form
- 1091 V → L: in dbSNP:rs45619033
- 1109 N → T: in dbSNP:rs45547640
- 1150 P → R: in dbSNP:rs1042036
- 1176 R → C: in dbSNP:rs45624433
- 1296 R → W: in dbSNP:rs45564939
- 1318 modified: Disulfide link with 509, In oxidase form
2e1qA Crystal structure of human xanthine oxidoreductase mutant, glu803val (see paper)
22% identity, 78% coverage: 8:217/268 of query aligns to 210:436/1307 of 2e1qA
- binding flavin-adenine dinucleotide: K230 (≠ R29), L231 (≠ I30), V232 (≠ I31), V233 (≠ A32), G234 (= G33), N235 (≠ G34), T236 (≠ Q35), E237 (≠ S36), I238 (≠ L37), F311 (≠ I101), A312 (≠ G102), V316 (≠ T106), A320 (≠ G110), S321 (≠ T111), G324 (= G114), N325 (≠ S115), I327 (≠ A117), T328 (≠ H118), S333 (≠ A123), D334 (≠ E124), I377 (≠ L166), L378 (≠ V167)
Sites not aligning to the query:
- active site: 742, 777, 855, 859, 887, 1235, 1236
- binding bicarbonate ion: 814, 815, 852, 886, 889, 890, 893
- binding calcium ion: 715, 716, 718, 741, 747, 780, 781, 784, 811, 812
- binding flavin-adenine dinucleotide: 43, 44
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 71, 110, 111, 112, 114, 146, 148, 719
- binding hydroxy(dioxo)molybdenum: 773, 774, 887, 1053, 1054, 1236
6a7xA Rat xanthine oxidoreductase, d428a variant, NAD bound form
21% identity, 78% coverage: 8:217/268 of query aligns to 208:434/1295 of 6a7xA
- binding flavin-adenine dinucleotide: K228 (≠ R29), L229 (≠ I30), V230 (≠ I31), V231 (≠ A32), G232 (= G33), N233 (≠ G34), T234 (≠ Q35), E235 (≠ S36), I236 (≠ L37), F309 (≠ I101), V314 (≠ T106), S319 (≠ T111), G322 (= G114), N323 (≠ S115), I325 (≠ A117), T326 (≠ H118), D332 (≠ E124), L376 (≠ V167)
- binding nicotinamide-adenine-dinucleotide: P329 (= P121), Y365 (≠ I156), R366 (≠ L157), A432 (= A215), D433 (= D216)
Sites not aligning to the query:
- active site: 740, 775, 853, 857, 885, 1233, 1234
- binding bicarbonate ion: 812, 813, 850, 883, 884, 887, 888, 891
- binding flavin-adenine dinucleotide: 44
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 69, 71, 109, 110, 111, 113, 145, 147
- binding nicotinamide-adenine-dinucleotide: 473, 480
- binding uric acid: 775, 853, 887, 982, 983, 1052, 1234
6a7xB Rat xanthine oxidoreductase, d428a variant, NAD bound form
21% identity, 78% coverage: 8:217/268 of query aligns to 206:432/1291 of 6a7xB
- binding flavin-adenine dinucleotide: L227 (≠ I30), V228 (≠ I31), V229 (≠ A32), G230 (= G33), N231 (≠ G34), T232 (≠ Q35), E233 (≠ S36), I234 (≠ L37), F307 (≠ I101), V312 (≠ T106), S317 (≠ T111), G320 (= G114), N321 (≠ S115), I323 (≠ A117), T324 (≠ H118), D330 (≠ E124), I373 (≠ L166), L374 (≠ V167)
- binding nicotinamide-adenine-dinucleotide: P327 (= P121), Y363 (≠ I156), R364 (≠ L157), G428 (= G213), A430 (= A215), D431 (= D216)
Sites not aligning to the query:
- active site: 738, 773, 851, 855, 883, 1231, 1232
- binding bicarbonate ion: 810, 811, 880, 881, 885, 886, 889
- binding flavin-adenine dinucleotide: 44
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 69, 71, 109, 110, 111, 113, 145, 147, 715
- binding nicotinamide-adenine-dinucleotide: 471, 478
- binding uric acid: 773, 851, 885, 980, 981, 1049, 1050, 1232
P22985 Xanthine dehydrogenase/oxidase; EC 1.17.1.4; EC 1.17.3.2 from Rattus norvegicus (Rat) (see 2 papers)
21% identity, 78% coverage: 8:217/268 of query aligns to 235:461/1331 of P22985
- 256:263 (vs. 30:37, 13% identical) binding
- WF 335:336 (≠ WI 100:101) mutation to AL: Converts the enzyme to the oxidase form that utilizes molecular oxygen as electron acceptor. Interferes with normal conversion to the dehydrogenase form by reducing agents.
- SIGGN 346:350 (≠ TVCGS 111:115) binding
- D359 (≠ E124) binding
- L403 (≠ V167) binding
Sites not aligning to the query:
- 43 binding
- 48 binding
- 51 binding
- 73 binding
- 112 binding
- 115 binding
- 147 binding
- 149 binding
- 535 C→A: Slows the conversion from the dehydrogenase form to the oxidase form; when associated with R-992. Abolishes conversion from the dehydrogenase form to the oxidase form; when associated with R-992 and S-1316.
- 992 C→R: Slows the conversion from the dehydrogenase form to the oxidase form; when associated with A-535. Abolishes conversion from the dehydrogenase form to the oxidase form; when associated with A-535 and S-1316.
- 1316 C→S: Abolishes conversion from the dehydrogenase form to the oxidase form; when associated with A-535 and R-992.
4yswA Structure of rat xanthine oxidoreductase, c-terminal deletion protein variant, nadh bound form (see paper)
21% identity, 78% coverage: 8:217/268 of query aligns to 206:432/1286 of 4yswA
- binding flavin-adenine dinucleotide: K226 (≠ R29), L227 (≠ I30), V228 (≠ I31), V229 (≠ A32), G230 (= G33), N231 (≠ G34), T232 (≠ Q35), E233 (≠ S36), I234 (≠ L37), F307 (≠ I101), A308 (≠ G102), V312 (≠ T106), A316 (≠ G110), S317 (≠ T111), G320 (= G114), N321 (≠ S115), I323 (≠ A117), T324 (≠ H118), S329 (≠ A123), D330 (≠ E124), I373 (≠ L166), L374 (≠ V167), D399 (≠ G191)
- binding 1,4-dihydronicotinamide adenine dinucleotide: E233 (≠ S36), S326 (≠ D120), P327 (= P121), I328 (≠ S122), Y363 (≠ I156), R364 (≠ L157), D400 (= D192), I401 (≠ F193), G428 (= G213), A430 (= A215), D431 (= D216)
Sites not aligning to the query:
- active site: 738, 773, 851, 855, 883, 1231, 1232
- binding bicarbonate ion: 810, 811, 848, 880, 881, 882, 885, 886, 889
- binding calcium ion: 838, 841, 842, 845, 878, 879
- binding flavin-adenine dinucleotide: 44
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 71, 110, 111, 113, 145, 147, 715
- binding 1,4-dihydronicotinamide adenine dinucleotide: 471, 478, 1196
- binding uric acid: 773, 851, 885, 980, 981, 1050, 1232
2ckjA Human milk xanthine oxidoreductase
20% identity, 78% coverage: 8:217/268 of query aligns to 207:429/1264 of 2ckjA
- binding flavin-adenine dinucleotide: L228 (≠ I30), V230 (≠ A32), G231 (= G33), N232 (≠ G34), T233 (≠ Q35), E234 (≠ S36), F308 (≠ I101), A309 (≠ G102), A317 (≠ G110), S318 (≠ T111), G321 (= G114), N322 (≠ S115), I324 (≠ A117), T325 (≠ H118), D331 (≠ E124), L375 (≠ V167)
Sites not aligning to the query:
- active site: 711, 746, 824, 828, 856, 1204, 1205
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 71, 111, 112, 114, 146, 147, 148
2e3tA Crystal structure of rat xanthine oxidoreductase mutant (w335a and f336l) (see paper)
25% identity, 42% coverage: 105:217/268 of query aligns to 313:434/1291 of 2e3tA
Sites not aligning to the query:
- active site: 740, 775, 853, 857, 885, 1233, 1234
- binding bicarbonate ion: 812, 813, 850, 882, 883, 887, 888, 891
- binding calcium ion: 713, 714, 716, 809, 810, 840, 843, 844, 847, 880, 881
- binding flavin-adenine dinucleotide: 44, 228, 229, 230, 231, 232, 233, 234, 235, 236, 309
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 69, 71, 109, 110, 113, 145, 147, 717
- binding uric acid: 775, 853, 887, 982, 983, 1051, 1052, 1234
3unaA Crystal structure of bovine milk xanthine dehydrogenase with NAD bound (see paper)
21% identity, 78% coverage: 8:217/268 of query aligns to 206:432/1286 of 3unaA
- binding flavin-adenine dinucleotide: L227 (≠ I30), V228 (≠ I31), V229 (≠ A32), G230 (= G33), N231 (≠ G34), T232 (≠ Q35), E233 (≠ S36), I234 (≠ L37), F307 (≠ I101), A308 (≠ G102), A316 (≠ G110), S317 (≠ T111), G320 (= G114), N321 (≠ S115), I323 (≠ A117), T324 (≠ H118), S329 (≠ A123), D330 (≠ E124), I373 (≠ L166), L374 (≠ V167)
- binding nicotinamide-adenine-dinucleotide: P327 (= P121), Y363 (≠ I156), R364 (≠ L157), A430 (= A215), D431 (= D216)
Sites not aligning to the query:
- active site: 729, 764, 842, 846, 874, 1222, 1223
- binding calcium ion: 829, 832, 833, 836, 869, 870
- binding carbonate ion: 801, 802, 871, 872, 876, 877, 880
- binding flavin-adenine dinucleotide: 43, 44
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 69, 71, 110, 111, 112, 114, 146, 148, 706
- binding nicotinamide-adenine-dinucleotide: 471, 478
Query Sequence
>AO356_26660 FitnessBrowser__pseudo5_N2C3_1:AO356_26660
MKPAAFDYVRADTRRQVVELLAEYGQEARIIAGGQSLMAVLNMRLAQPKLLIDINHVAEL
AYIELRKDCLAVGAGVRQAQLLARSTLMDEVPLLALAMPWIGHFQTRNRGTVCGSVAHAD
PSAELPLCLVTLGGEIVLESKKGKRIVKAADFFQGILTTDKRADELVVEVRFPLKREGIT
YRFREIAMRHGDFAIVSLAAAIGADQVELGIGGVADRPQRRSLPRGAGLPDALNQTAWSL
DAQDDVQASAAYRRQLIRELGHQLIEGV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory