SitesBLAST
Comparing AO356_26665 FitnessBrowser__pseudo5_N2C3_1:AO356_26665 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1t3qB Crystal structure of quinoline 2-oxidoreductase from pseudomonas putida 86 (see paper)
33% identity, 78% coverage: 15:798/999 of query aligns to 14:778/786 of 1t3qB
- active site: Q224 (= Q223), A259 (≠ Q259), E336 (≠ Y336), V343 (vs. gap), R371 (= R369), E743 (= E766), S744 (≠ G767)
- binding pterin cytosine dinucleotide: G254 (≠ S254), F255 (= F255), R371 (= R369), S506 (≠ Q513), G507 (= G514), Q508 (= Q515), H510 (= H517), T513 (= T520), Y545 (= Y556), S547 (= S558), G549 (≠ F560), A550 (= A561), C666 (≠ A689), I670 (≠ L693), I674 (≠ L697), V675 (= V698), Q678 (= Q701), K739 (= K762), G740 (= G763), M741 (≠ V764), G742 (= G765)
1ffvB Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava (see paper)
32% identity, 78% coverage: 15:798/999 of query aligns to 12:786/797 of 1ffvB
- active site: Q231 (= Q223), V266 (≠ Q259), P343 (vs. gap), I349 (≠ N341), R378 (≠ N368), C379 (≠ R369), E751 (= E766), S752 (≠ G767)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): G260 (= G253), G261 (≠ S254), F262 (= F255), G263 (= G256), A376 (vs. gap), R378 (≠ N368), C379 (≠ R369), Q516 (= Q513), G517 (= G514), Q518 (= Q515), H520 (= H517), T523 (= T520), Y556 (= Y556), G557 (≠ S557), S558 (= S558), S560 (≠ F560), T561 (≠ A561), C674 (≠ A689), I678 (≠ L693), I683 (≠ V698), Q686 (= Q701), K747 (= K762), G748 (= G763), V749 (= V764), A750 (≠ G765), E751 (= E766)
1ffuB Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor (see paper)
32% identity, 78% coverage: 15:798/999 of query aligns to 12:786/797 of 1ffuB
- active site: Q231 (= Q223), V266 (≠ Q259), P343 (vs. gap), I349 (≠ N341), R378 (≠ N368), C379 (≠ R369), E751 (= E766), S752 (≠ G767)
- binding cytidine-5'-diphosphate: Q518 (= Q515), H520 (= H517), T523 (= T520), S558 (= S558), S560 (≠ F560), T561 (≠ A561), C674 (≠ A689), T676 (≠ R691), I678 (≠ L693), I683 (≠ V698), K747 (= K762), G748 (= G763), V749 (= V764), A750 (≠ G765)
P19913 Carbon monoxide dehydrogenase large chain; CO dehydrogenase subunit L; CO-DH L; EC 1.2.5.3 from Hydrogenophaga pseudoflava (Pseudomonas carboxydoflava) (see paper)
31% identity, 78% coverage: 18:798/999 of query aligns to 21:792/803 of P19913
- R384 (≠ N368) modified: 4-hydroxyarginine
7dqxD Crystal structure of xanthine dehydrogenase family protein
33% identity, 78% coverage: 15:798/999 of query aligns to 6:762/770 of 7dqxD
- binding pterin cytosine dinucleotide: G247 (= G253), S248 (= S254), F249 (= F255), R363 (= R369), V491 (≠ Q513), G492 (= G514), Q493 (= Q515), G494 (= G516), V498 (≠ T520), S530 (≠ N555), W531 (≠ Y556), S532 (= S557), S533 (= S558), R534 (= R559), S535 (≠ F560), T536 (≠ A561), T658 (≠ L697), T659 (≠ V698), Q662 (= Q701), G725 (= G763), L726 (≠ V764), G727 (= G765), E728 (= E766)
1n60B Crystal structure of the cu,mo-co dehydrogenase (codh); cyanide- inactivated form (see paper)
31% identity, 78% coverage: 15:792/999 of query aligns to 15:786/803 of 1n60B
- active site: Q234 (= Q223), V269 (≠ Q259), P346 (≠ Y336), I352 (≠ L342), R381 (≠ N368), C382 (≠ R369), E757 (= E766), S758 (≠ G767)
- binding pterin cytosine dinucleotide: G264 (≠ S254), F265 (= F255), R381 (≠ N368), Q522 (= Q513), G523 (= G514), Q524 (= Q515), H526 (= H517), T529 (= T520), T561 (≠ N555), Y562 (= Y556), G563 (≠ S557), S564 (= S558), S566 (≠ F560), T567 (≠ A561), C680 (≠ A689), I684 (≠ L693), I688 (≠ L697), I689 (≠ V698), Q692 (= Q701), K753 (= K762), G754 (= G763), V755 (= V764), E757 (= E766)
- binding mo(vi)(=o)(oh)2 cluster: F265 (= F255), G266 (= G256), Y562 (= Y556), G563 (≠ S557), E757 (= E766)
1zxiB Reconstituted co dehydrogenase from oligotropha carboxidovorans (see paper)
31% identity, 78% coverage: 15:792/999 of query aligns to 16:787/804 of 1zxiB
- active site: Q235 (= Q223), V270 (≠ Q259), P347 (≠ Y336), I353 (≠ L342), R382 (≠ N368), C383 (≠ R369), E758 (= E766), S759 (≠ G767)
- binding copper (ii) ion: C383 (≠ R369), S384 (≠ G370), E758 (= E766)
- binding cu(i)-s-mo(vi)(=o)oh cluster: F266 (= F255), G267 (= G256), A380 (vs. gap), Y381 (vs. gap), R382 (≠ N368), C383 (≠ R369), Y563 (= Y556), G564 (≠ S557), E758 (= E766)
- binding pterin cytosine dinucleotide: G265 (≠ S254), F266 (= F255), R382 (≠ N368), Q523 (= Q513), G524 (= G514), Q525 (= Q515), H527 (= H517), T530 (= T520), T562 (≠ N555), Y563 (= Y556), S565 (= S558), S567 (≠ F560), T568 (≠ A561), C681 (≠ A689), I685 (≠ L693), I689 (≠ L697), I690 (≠ V698), Q693 (= Q701), K754 (= K762), G755 (= G763), V756 (= V764), E758 (= E766)
P19919 Carbon monoxide dehydrogenase large chain; CO dehydrogenase subunit L; CO-DH L; EC 1.2.5.3 from Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5) (Oligotropha carboxidovorans) (see 2 papers)
31% identity, 78% coverage: 15:792/999 of query aligns to 21:792/809 of P19919
- C388 (≠ R369) binding
- E763 (= E766) binding
1n62B Crystal structure of the mo,cu-co dehydrogenase (codh), n- butylisocyanide-bound state (see paper)
31% identity, 78% coverage: 15:792/999 of query aligns to 16:787/804 of 1n62B
- active site: Q235 (= Q223), V270 (≠ Q259), P347 (≠ Y336), I353 (≠ L342), R382 (≠ N368), C383 (≠ R369), E758 (= E766), S759 (≠ G767)
- binding cu(i)-s-mo(iv)(=o)o-nbic cluster: G267 (= G256), V379 (≠ L367), A380 (vs. gap), R382 (≠ N368), C383 (≠ R369), F385 (= F371), Y563 (= Y556), G564 (≠ S557), E758 (= E766)
- binding pterin cytosine dinucleotide: G265 (≠ S254), F266 (= F255), R382 (≠ N368), Q523 (= Q513), G524 (= G514), Q525 (= Q515), H527 (= H517), T530 (= T520), T562 (≠ N555), Y563 (= Y556), G564 (≠ S557), S565 (= S558), S567 (≠ F560), T568 (≠ A561), C681 (≠ A689), I685 (≠ L693), I689 (≠ L697), I690 (≠ V698), Q693 (= Q701), K754 (= K762), G755 (= G763), V756 (= V764), G757 (= G765), E758 (= E766)
1n5wB Crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form (see paper)
31% identity, 78% coverage: 15:792/999 of query aligns to 16:787/804 of 1n5wB
- active site: Q235 (= Q223), V270 (≠ Q259), P347 (≠ Y336), I353 (≠ L342), R382 (≠ N368), C383 (≠ R369), E758 (= E766), S759 (≠ G767)
- binding cu(i)-s-mo(vi)(=o)oh cluster: G267 (= G256), A380 (vs. gap), R382 (≠ N368), C383 (≠ R369), Y563 (= Y556), G564 (≠ S557), E758 (= E766)
- binding pterin cytosine dinucleotide: G265 (≠ S254), F266 (= F255), R382 (≠ N368), Q523 (= Q513), G524 (= G514), Q525 (= Q515), H527 (= H517), T530 (= T520), T562 (≠ N555), Y563 (= Y556), S565 (= S558), S567 (≠ F560), T568 (≠ A561), C681 (≠ A689), I685 (≠ L693), I689 (≠ L697), I690 (≠ V698), Q693 (= Q701), K754 (= K762), G755 (= G763), V756 (= V764), E758 (= E766)
1n63B Crystal structure of the cu,mo-co dehydrogenase (codh); carbon monoxide reduced state (see paper)
31% identity, 78% coverage: 15:792/999 of query aligns to 17:788/805 of 1n63B
- active site: Q236 (= Q223), V271 (≠ Q259), P348 (≠ Y336), I354 (≠ L342), R383 (≠ N368), C384 (≠ R369), E759 (= E766), S760 (≠ G767)
- binding cu(i)-s-mo(iv)(=o)oh cluster: G268 (= G256), A381 (vs. gap), R383 (≠ N368), C384 (≠ R369), Y564 (= Y556), G565 (≠ S557), E759 (= E766)
- binding pterin cytosine dinucleotide: G266 (≠ S254), F267 (= F255), R383 (≠ N368), Q524 (= Q513), G525 (= G514), Q526 (= Q515), H528 (= H517), T531 (= T520), T563 (≠ N555), Y564 (= Y556), S566 (= S558), S568 (≠ F560), T569 (≠ A561), C682 (≠ A689), I686 (≠ L693), I690 (≠ L697), I691 (≠ V698), Q694 (= Q701), K755 (= K762), G756 (= G763), V757 (= V764), E759 (= E766)
4zohA Crystal structure of glyceraldehyde oxidoreductase (see paper)
29% identity, 78% coverage: 14:793/999 of query aligns to 2:695/701 of 4zohA
- active site: Q186 (≠ Y226), I219 (≠ Q259), V298 (vs. gap), S300 (vs. gap), M304 (vs. gap), R332 (= R369), E668 (= E766), A669 (≠ G767)
- binding pterin cytosine dinucleotide: G213 (= G253), A214 (≠ S254), F215 (= F255), R332 (= R369), H442 (≠ Q513), G443 (= G514), Q444 (= Q515), D446 (≠ H517), W482 (≠ Y556), S484 (= S558), T486 (≠ F560), V487 (≠ A561), I594 (≠ L693), N595 (= N694), L598 (= L697), Q602 (= Q701), K664 (= K762), G665 (= G763), I666 (≠ V764), G667 (= G765), E668 (= E766)
1rm6A Structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica (see paper)
28% identity, 79% coverage: 13:806/999 of query aligns to 1:758/761 of 1rm6A
- active site: Q206 (= Q223), T241 (≠ Q259), Y318 (= Y336), L322 (vs. gap), R350 (= R369), E718 (= E766), G719 (= G767)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): G235 (= G253), G236 (≠ S254), F237 (= F255), G238 (= G256), R350 (= R369), I473 (≠ Q513), G474 (= G514), Q475 (= Q515), G476 (= G516), Y513 (= Y556), S514 (= S557), S515 (= S558), V517 (≠ F560), T518 (≠ A561), L646 (= L693), N647 (= N694), V651 (= V698), Q654 (= Q701), K714 (= K762), E715 (≠ G763), A716 (≠ V764), S717 (≠ G765), E718 (= E766)
O33819 4-hydroxybenzoyl-CoA reductase subunit alpha; 4-HBCR subunit alpha; EC 1.1.7.1 from Thauera aromatica (see paper)
28% identity, 80% coverage: 11:806/999 of query aligns to 7:766/769 of O33819
3unaA Crystal structure of bovine milk xanthine dehydrogenase with NAD bound (see paper)
24% identity, 81% coverage: 6:810/999 of query aligns to 526:1264/1286 of 3unaA
- active site: Q729 (= Q223), E764 (≠ Q259), R842 (= R337), H846 (≠ N341), R874 (= R369), G1222 (= G765), E1223 (= E766)
- binding calcium ion: A829 (≠ C323), S832 (≠ Y326), R833 (= R328), S836 (≠ E331), S869 (≠ P364), N870 (≠ S365)
- binding carbonate ion: R801 (≠ A295), H802 (≠ T296), T871 (≠ G366), A872 (≠ L367), F876 (= F371), G877 (= G372), Q880 (= Q375)
- binding fe2/s2 (inorganic) cluster: L706 (≠ I200)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 43, 44, 227, 228, 229, 230, 231, 232, 233, 234, 307, 308, 316, 317, 320, 321, 323, 324, 329, 330, 373, 374
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 69, 71, 110, 111, 112, 114, 146, 148
- binding nicotinamide-adenine-dinucleotide: 327, 363, 364, 430, 431, 471, 478
3bdjA Crystal structure of bovine milk xanthine dehydrogenase with a covalently bound oxipurinol inhibitor (see paper)
24% identity, 81% coverage: 6:810/999 of query aligns to 526:1264/1286 of 3bdjA
- active site: Q729 (= Q223), E764 (≠ Q259), R842 (= R337), H846 (≠ N341), R874 (= R369), G1222 (= G765), E1223 (= E766)
- binding Oxypurinol: E764 (≠ Q259), R842 (= R337), F876 (= F371), F971 (≠ Y458), T972 (≠ A459), A1040 (≠ Y556), A1041 (≠ S557), E1223 (= E766)
- binding calcium ion: A829 (≠ C323), S832 (≠ Y326), R833 (= R328), S836 (≠ E331), S869 (≠ P364), N870 (≠ S365)
- binding carbonate ion: R801 (≠ A295), H802 (≠ T296), T871 (≠ G366), A872 (≠ L367), F876 (= F371), G877 (= G372), Q880 (= Q375)
- binding fe2/s2 (inorganic) cluster: L706 (≠ I200)
- binding Oxo(sulfanyl)molybdenum(IV) ION: G761 (= G256), A872 (≠ L367), F873 (≠ N368), R874 (= R369), E1223 (= E766)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 43, 44, 227, 228, 229, 230, 231, 232, 233, 234, 307, 308, 316, 317, 320, 321, 323, 324, 329, 330, 373, 374
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 69, 71, 110, 111, 112, 114, 146, 148
1v97A Crystal structure of bovine milk xanthine dehydrogenase fyx-051 bound form (see paper)
24% identity, 81% coverage: 6:810/999 of query aligns to 530:1268/1298 of 1v97A
- active site: Q733 (= Q223), E768 (≠ Q259), R846 (= R337), H850 (≠ N341), R878 (= R369), G1226 (= G765), E1227 (= E766)
- binding calcium ion: A833 (≠ C323), S836 (≠ Y326), R837 (= R328), S840 (≠ E331), S873 (≠ P364), N874 (≠ S365)
- binding fe2/s2 (inorganic) cluster: L710 (≠ I200)
- binding 4-(5-pyridin-4-yl-1h-1,2,4-triazol-3-yl)pyridine-2-carbonitrile: E768 (≠ Q259), L839 (≠ P330), R846 (= R337), F880 (= F371), F975 (≠ Y458), L980 (≠ I466), P1042 (≠ G554), A1044 (≠ Y556), A1045 (≠ S557), E1227 (= E766)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 43, 44, 228, 229, 230, 231, 232, 233, 234, 235, 236, 309, 310, 318, 319, 322, 323, 325, 326, 331, 332, 375, 376
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 71, 110, 111, 112, 114, 146, 148
1vdvA Bovine milk xanthine dehydrogenase y-700 bound form (see paper)
24% identity, 81% coverage: 6:810/999 of query aligns to 531:1269/1299 of 1vdvA
- active site: Q734 (= Q223), E769 (≠ Q259), R847 (= R337), H851 (≠ N341), R879 (= R369), G1227 (= G765), E1228 (= E766)
- binding calcium ion: H708 (≠ C197), Y710 (≠ P199), T803 (≠ A292), G804 (≠ S293), A834 (≠ C323), S837 (≠ Y326), R838 (= R328), S841 (≠ E331), S874 (≠ P364), N875 (≠ S365)
- binding fe2/s2 (inorganic) cluster: L711 (≠ I200)
- binding 1-[3-cyano-4-(neopentyloxy)phenyl]-1h-pyrazole-4-carboxylic acid: E769 (≠ Q259), L840 (≠ P330), S843 (≠ A333), R847 (= R337), F881 (= F371), F976 (≠ Y458), T977 (≠ A459), V978 (≠ A460), L981 (≠ I466), P1043 (≠ G554), A1046 (≠ S557)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 43, 44, 229, 230, 231, 232, 233, 234, 235, 236, 309, 310, 318, 319, 322, 323, 325, 326, 331, 332, 375, 376
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 71, 110, 111, 112, 114, 146, 148
3amzA Bovine xanthine oxidoreductase urate bound form (see paper)
24% identity, 81% coverage: 6:810/999 of query aligns to 528:1266/1291 of 3amzA
- active site: Q731 (= Q223), E766 (≠ Q259), R844 (= R337), H848 (≠ N341), R876 (= R369), G1224 (= G765), E1225 (= E766)
- binding bicarbonate ion: R803 (≠ A295), H804 (≠ T296), T873 (≠ G366), A874 (≠ L367), F878 (= F371), G879 (= G372), Q882 (= Q375)
- binding calcium ion: A831 (≠ C323), S834 (≠ Y326), R835 (= R328), S838 (≠ E331), S871 (≠ P364), N872 (≠ S365)
- binding fe2/s2 (inorganic) cluster: L708 (≠ I200)
- binding 1,4-dihydronicotinamide adenine dinucleotide: S1189 (≠ A732)
- binding uric acid: E766 (≠ Q259), R844 (= R337), F878 (= F371), F973 (≠ Y458), T974 (≠ A459), A1043 (≠ S557), E1225 (= E766)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 44, 229, 230, 231, 232, 233, 234, 235, 236, 309, 318, 319, 322, 323, 325, 326, 331, 332, 375, 376
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 71, 110, 111, 112, 114, 146, 148
- binding 1,4-dihydronicotinamide adenine dinucleotide: 328, 329, 330, 365, 366, 402, 403, 430, 432, 433, 473, 480
3am9A Complex of bovine xanthine dehydrogenase and trihydroxy fyx-051 (see paper)
24% identity, 81% coverage: 6:810/999 of query aligns to 530:1268/1293 of 3am9A
- active site: Q733 (= Q223), E768 (≠ Q259), R846 (= R337), H850 (≠ N341), R878 (= R369), G1226 (= G765), E1227 (= E766)
- binding bicarbonate ion: R805 (≠ A295), H806 (≠ T296), T875 (≠ G366), A876 (≠ L367), F877 (≠ N368), Q884 (= Q375)
- binding calcium ion: H707 (≠ C197), Y709 (≠ P199), T802 (≠ A292), G803 (≠ S293), A833 (≠ C323), S836 (≠ Y326), R837 (= R328), S840 (≠ E331), S873 (≠ P364), N874 (≠ S365)
- binding fe2/s2 (inorganic) cluster: L710 (≠ I200)
- binding 4-[5-(2,6-dioxo-1,2,3,6-tetrahydropyridin-4-yl)-1H-1,2,4-triazol-3-yl]-6-oxo-1,6-dihydropyridine-2-carbonitrile: L614 (≠ Q95), E768 (≠ Q259), L839 (≠ P330), S842 (≠ A333), R846 (= R337), F880 (= F371), F975 (≠ Y458), L980 (≠ I466), A1045 (≠ S557), E1227 (= E766)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 43, 44, 228, 229, 231, 232, 233, 234, 235, 236, 309, 310, 314, 318, 319, 322, 323, 325, 326, 332, 376, 394
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 71, 111, 112, 114, 146, 148
Query Sequence
>AO356_26665 FitnessBrowser__pseudo5_N2C3_1:AO356_26665
MTSFQPATESQTGHIGARQTRVEDAALLRGLGCYADDAAIPPGTLHAAIIRSPHAHARIT
SVDFSSALLMKGVHGVLVGEDVKRWALPFPVGVRQPMEHWCVAVDKVRYVGEPVAVVIAE
SRYLAEDAIEGVRVEYEPLPPIIDPERATAEQAPILHEAVGSNVVNERRFRYGEPEQAFE
QAPHKVSLKVKFPRSSCTPIECYVVLAQYERATGIYDVLANFQGPYALHTVMARALNVPG
NRLRLRTPKDSGGSFGIKQGVFPYVVMMGLASRKVGAPVKWVEDRLEHLQGASSATNRVT
EIEAAVEADGRITALRYDQIDDCGAYLRAPEPATFYRMHGNLTGAYAIRNLQVRNRVVLT
NKTPSGLNRGFGGPQVYFALERLMQHIAVQLKLDPLDVIRRNLVPADAFPYRAAAGALLD
SGNYQAGIALAAADGGLDELLKRRDQARAEGRIYGIGYAAVIEPSISNMGYITTAMTPEE
RRKAGPKNGAVATATINVGPLGDVSVHVSSAPQGQGHQTTVAQVVAEVLGVALESIVVNV
ELDTQKDAWSIASGNYSSRFAGAVAGAVYKAALKIRDRLAAIAAEQLQASPEDIRFAGGK
IFVVNGGAVAPFHRIAGATHWSPGLLPEGESGGLRETAFWSPPQLVAPDDQDQVNSSLCY
GFVFDICGLEIDRMTGEIHIDRYVTCHDAGRLLNPALVDGQIRGGFTQGLGAALMEEFAY
GEDGSFLSGTFADYLVPTAPEAIEPVILHMETPSPFTPLGAKGVGEGNNMSTPVCIANAV
ADALGRSDIRLPLTPSKVRTLIGIDEPPRPAGMEPDEDLDAAPAGGPALRANDSVVIPAS
PQQVFDTLLDPQTLAAIIPGCHDLVLEGENRYRADVTVGVGMIRARFEAKVALSDLDPPH
SLRLSGSGSSSMGSAQGQAKVRFVELENGHTRLEYQYQVAVSGKVAAVGGRMLQGASKVI
IGQIFTRLSQRVSGQAISTSWWARLRASLGAMFGKGGAQ
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory