SitesBLAST
Comparing AO356_27130 FitnessBrowser__pseudo5_N2C3_1:AO356_27130 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5dx5A Crystal structure of methionine gamma-lyase from clostridium sporogenes (see paper)
39% identity, 99% coverage: 6:400/400 of query aligns to 1:399/399 of 5dx5A
- active site: R59 (= R62), Y112 (= Y115), D186 (= D188), K211 (= K213)
- binding pyridoxal-5'-phosphate: Y57 (= Y60), R59 (= R62), S86 (≠ T89), G87 (= G90), M88 (≠ V91), Y112 (= Y115), D186 (= D188), F189 (= F191), S208 (= S210), T210 (= T212), K211 (= K213)
6egrA Crystal structure of citrobacter freundii methionine gamma-lyase with v358y replacement (see paper)
38% identity, 95% coverage: 15:395/400 of query aligns to 10:392/396 of 6egrA
4omaA The crystal structure of methionine gamma-lyase from citrobacter freundii in complex with l-cycloserine pyridoxal-5'-phosphate (see paper)
38% identity, 95% coverage: 15:395/400 of query aligns to 10:392/396 of 4omaA
- active site: R59 (= R62), Y112 (= Y115), D184 (= D188), K209 (= K213)
- binding [5-hydroxy-6-methyl-4-({[(4E)-3-oxo-1,2-oxazolidin-4-ylidene]amino}methyl)pyridin-3-yl]methyl dihydrogen phosphate: G87 (= G90), I88 (≠ V91), Y112 (= Y115), D184 (= D188), S206 (= S210), T208 (= T212), K209 (= K213), V337 (= V342), S338 (= S343), R373 (= R376)
3jwbA Crystal structure of l-methionine gamma-lyase from citrobacter freundii with norleucine (see paper)
38% identity, 95% coverage: 15:395/400 of query aligns to 10:392/396 of 3jwbA
3jwaA Crystal structure of l-methionine gamma-lyase from citrobacter freundii with methionine phosphinate (see paper)
38% identity, 95% coverage: 15:395/400 of query aligns to 10:392/396 of 3jwaA
3jw9A Crystal structure of l-methionine gamma-lyase from citrobacter freundii with s-ethyl-cysteine (see paper)
38% identity, 95% coverage: 15:395/400 of query aligns to 10:392/396 of 3jw9A
4hf8A Crystal structure of l-methionine gamma-lyase from citrobacter freundii with glycine (see paper)
38% identity, 95% coverage: 15:395/400 of query aligns to 10:392/396 of 4hf8A
- active site: R59 (= R62), Y112 (= Y115), D184 (= D188), K209 (= K213)
- binding n-glycine-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-yl-methane]: G87 (= G90), I88 (≠ V91), Y112 (= Y115), E155 (= E159), N159 (= N163), D184 (= D188), S206 (= S210), K209 (= K213), S338 (= S343), R373 (= R376)
5m3zA Crystal structure of citrobacter freundii methionine gamma-lyase with c115h replacement in the complex with l-norleucine (see paper)
38% identity, 95% coverage: 15:395/400 of query aligns to 9:391/395 of 5m3zA
- active site: R58 (= R62), Y111 (= Y115), D183 (= D188), K208 (= K213)
- binding norleucine: Y111 (= Y115), H113 (≠ A117), K208 (= K213), V336 (= V342), S337 (= S343)
- binding pyridoxal-5'-phosphate: G86 (= G90), I87 (≠ V91), Y111 (= Y115), E154 (= E159), D183 (= D188), T185 (= T190), S205 (= S210), T207 (= T212), K208 (= K213)
- binding 2-[o-phosphonopyridoxyl]-amino-hexanoic acid: G86 (= G90), I87 (≠ V91), Y111 (= Y115), D183 (= D188), S205 (= S210), T207 (= T212), K208 (= K213), V336 (= V342), S337 (= S343), R372 (= R376)
3mkjA Methionine gamma-lyase from citrobacter freundii with pyridoximine-5'- phosphate (see paper)
37% identity, 96% coverage: 15:399/400 of query aligns to 10:386/386 of 3mkjA
- active site: Y101 (= Y115), D173 (= D188), K198 (= K213)
- binding [5-hydroxy-4-(iminomethyl)-6-methyl-pyridin-3-yl]methyl dihydrogen phosphate: G76 (= G90), I77 (≠ V91), Y101 (= Y115), E144 (= E159), D173 (= D188), F176 (= F191), S195 (= S210), T197 (= T212), K198 (= K213)
5x2xA Crystal structure of pseudomonas putida methionine gamma-lyase wild type with l-homocysteine intermediates (see paper)
36% identity, 96% coverage: 14:398/400 of query aligns to 5:391/392 of 5x2xA
- active site: R55 (= R62), Y108 (= Y115), D180 (= D188), K205 (= K213)
- binding (2E)-2-{[(1E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}but-2-enoic acid: Y53 (= Y60), R55 (= R62), G83 (= G90), M84 (≠ V91), Y108 (= Y115), N155 (= N163), D180 (= D188), S202 (= S210), T204 (= T212), K205 (= K213), V333 (= V342), S334 (= S343), R369 (= R376)
5x2wA Crystal structure of pseudomonas putida methionine gamma-lyase wild type with l-methionine intermediates (see paper)
36% identity, 96% coverage: 14:398/400 of query aligns to 5:391/392 of 5x2wA
- active site: R55 (= R62), Y108 (= Y115), D180 (= D188), K205 (= K213)
- binding (2E)-2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]-4-(methylsulfanyl)but-2-enoic acid: Y53 (= Y60), R55 (= R62), S82 (≠ T89), G83 (= G90), M84 (≠ V91), Y108 (= Y115), D180 (= D188), S202 (= S210), K205 (= K213), V333 (= V342), S334 (= S343), R369 (= R376)
1pg8A Crystal structure of l-methionine alpha-, gamma-lyase
36% identity, 96% coverage: 14:398/400 of query aligns to 11:397/398 of 1pg8A
- active site: R61 (= R62), Y114 (= Y115), D186 (= D188), K211 (= K213)
- binding pyridoxal-5'-phosphate: Y59 (= Y60), R61 (= R62), S88 (≠ T89), G89 (= G90), M90 (≠ V91), Y114 (= Y115), D186 (= D188), S208 (= S210), T210 (= T212), K211 (= K213)
P13254 L-methionine gamma-lyase; MGL; Homocysteine desulfhydrase; L-methioninase; EC 4.4.1.11; EC 4.4.1.2 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 3 papers)
36% identity, 96% coverage: 14:398/400 of query aligns to 11:397/398 of P13254
- YSR 59:61 (≠ YTR 60:62) binding
- R61 (= R62) mutation R->A,E,F: Loss of elimination activity against L-methionine.
- GM 89:90 (≠ GV 90:91) binding in other chain
- Y114 (= Y115) binding
- C116 (≠ A117) mutation to H: Drastic decrease of the catalytic efficiency of the elimination reaction with L-methionine, by 6700-fold, and increases that with L-cysteine by 7-fold, mainly due to changes in kcat. Loss of ability to catalyze replacement reaction between L-methionine and 2-mercaptoethanol.; mutation to S: 9% of wild-type elimination activity against L-methionine.; mutation to T: 40% of wild-type elimination activity against L-methionine.
- SAT 208:210 (≠ SLT 210:212) binding in other chain
- K211 (= K213) modified: N6-(pyridoxal phosphate)lysine
- K240 (≠ V242) mutation K->D,E: Marked decrease in elimination activity against both L-methionine and DL-homocysteine.; mutation to M: 50% reduction in alpha,gamma-elimination activity against DL-homocysteine, while retaining elimination activity against L-methionine and L-cysteine.
- D241 (= D243) mutation D->H,R: 5 to 14-fold reduction in alpha,gamma-elimination activity against L-methionine, while no change in affinity for L-methionine.
- R375 (= R376) binding
4iyoB Crystal structure of cystathionine gamma lyase from xanthomonas oryzae pv. Oryzae (xometc) in complex with e-site serine, a-site serine, a- site external aldimine structure with aminoacrylate and a-site iminopropionate intermediates (see paper)
38% identity, 96% coverage: 11:395/400 of query aligns to 2:380/381 of 4iyoB
- active site: R47 (= R62), Y99 (= Y115), D172 (= D188), K197 (= K213)
- binding 2-{[(E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}prop-2-enoic acid: Y45 (= Y60), R47 (= R62)
- binding amino-acrylate: Y99 (= Y115), K197 (= K213), S326 (= S343), T341 (≠ G358), R361 (= R376)
- binding pyruvic acid: Q221 (≠ I236), F224 (≠ D239)
- binding serine: Y45 (= Y60), T48 (≠ N63), Y99 (= Y115), R104 (= R120), N227 (≠ V242), E325 (≠ V342)
4iy7B Crystal structure of cystathionine gamma lyase (xometc) from xanthomonas oryzae pv. Oryzae in complex with e-site serine, a-site external aldimine structure with serine and a-site external aldimine structure with aminoacrylate intermediates (see paper)
38% identity, 96% coverage: 11:395/400 of query aligns to 2:380/381 of 4iy7B
- active site: R47 (= R62), Y99 (= Y115), D172 (= D188), K197 (= K213)
- binding 2-{[(E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}prop-2-enoic acid: Y45 (= Y60), R47 (= R62)
- binding (E)-N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)-L-serine: G75 (= G90), M76 (≠ V91), Y99 (= Y115), E143 (= E159), N147 (= N163), D172 (= D188), S194 (= S210), K197 (= K213), S326 (= S343), L327 (= L344), T341 (≠ G358), R361 (= R376)
- binding pyruvic acid: Q221 (≠ I236), F224 (≠ D239)
- binding serine: Y45 (= Y60), T48 (≠ N63), Y99 (= Y115), R104 (= R120), N227 (≠ V242), E325 (≠ V342)
4iy7A Crystal structure of cystathionine gamma lyase (xometc) from xanthomonas oryzae pv. Oryzae in complex with e-site serine, a-site external aldimine structure with serine and a-site external aldimine structure with aminoacrylate intermediates (see paper)
38% identity, 96% coverage: 11:395/400 of query aligns to 2:380/381 of 4iy7A
- active site: R47 (= R62), Y99 (= Y115), D172 (= D188), K197 (= K213)
- binding 2-{[(E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}prop-2-enoic acid: G75 (= G90), M76 (≠ V91), Y99 (= Y115), E143 (= E159), N147 (= N163), D172 (= D188), S194 (= S210), K197 (= K213), S326 (= S343), L327 (= L344), T341 (≠ G358), R361 (= R376)
- binding (E)-N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)-L-serine: Y45 (= Y60), R47 (= R62)
- binding serine: Y45 (= Y60), T48 (≠ N63), Y99 (= Y115), R104 (= R120), N227 (≠ V242), E325 (≠ V342)
4ixzA Native structure of cystathionine gamma lyase (xometc) from xanthomonas oryzae pv. Oryzae at ph 9.0 (see paper)
38% identity, 96% coverage: 11:395/400 of query aligns to 2:380/381 of 4ixzA
4iyoD Crystal structure of cystathionine gamma lyase from xanthomonas oryzae pv. Oryzae (xometc) in complex with e-site serine, a-site serine, a- site external aldimine structure with aminoacrylate and a-site iminopropionate intermediates (see paper)
38% identity, 96% coverage: 11:395/400 of query aligns to 2:380/384 of 4iyoD
- active site: R47 (= R62), Y99 (= Y115), D172 (= D188), K197 (= K213)
- binding serine: Y45 (= Y60), T48 (≠ N63), Y99 (= Y115), Y99 (= Y115), R104 (= R120), K197 (= K213), N227 (≠ V242), E325 (≠ V342), S326 (= S343), T341 (≠ G358), R361 (= R376)
5x30C Crystal structure of pseudomonas putida methionine gamma-lyase c116h mutant with l-homocysteine intermediates. (see paper)
36% identity, 96% coverage: 14:398/400 of query aligns to 6:392/393 of 5x30C
3vk3A Crystal structure of l-methionine gamma-lyase from pseudomonas putida c116h mutant complexed with l-methionine (see paper)
36% identity, 96% coverage: 14:398/400 of query aligns to 10:396/397 of 3vk3A
Query Sequence
>AO356_27130 FitnessBrowser__pseudo5_N2C3_1:AO356_27130
MRPDKHNLSTLSAATLAVHGGNVADVTSGAVRTPLVMANSYLLPEDPATMDWSSPDGLVY
TRNQGHNQVCLEKKLAALEGCEDAVVFATGVAALHSVFFSFLKSGDHVIVSDITYQAVWR
LFAELLPERYGIEATFVDVGDLESVRNAIRPNTKLIHTETIANPTTKVADIAALAEIAHA
HGALISVDATFTPPPFFRASQHGVDFVIHSLTKYINGHGDAMGGVVIGSNPLINKIKNDA
LVDLGATISPFNAWMIMRGSVTLPLRLKQLLNTAEKLAQFLDSDDRIAYVYYPGLPSHPQ
HKLARRQFAGKGYGAVMAFAVEGDPDTQNRFVSNLRIITSAVSLGHDESLIVHVGAEGRG
GFDKYPEEFRQYGHLRFSVGLEDPEDLIKDITFALDATFK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory