SitesBLAST
Comparing AO356_27140 FitnessBrowser__pseudo5_N2C3_1:AO356_27140 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 19 hits to proteins with known functional sites (download)
6dzsA Mycobacterial homoserine dehydrogenase thra in complex with NADP
34% identity, 99% coverage: 6:349/349 of query aligns to 7:330/431 of 6dzsA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G10), L12 (≠ F11), G13 (= G12), N14 (≠ G13), V15 (= V14), V45 (≠ F71), R46 (= R72), R47 (≠ T73), R52 (≠ S78), I63 (vs. gap), L78 (≠ F100), M79 (≠ T101), P84 (= P108), A102 (≠ T126), K104 (= K128), G306 (= G325), T310 (= T329)
7f4cA The crystal structure of the immature holo-enzyme of homoserine dehydrogenase complexed with NADP and 1,4-butandiol from the hyperthermophilic archaeon sulfurisphaera tokodaii. (see paper)
32% identity, 96% coverage: 5:338/349 of query aligns to 2:293/300 of 7f4cA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: F6 (≠ L9), G7 (= G10), Y8 (≠ F11), G9 (= G12), N10 (≠ G13), V11 (= V14), T37 (≠ N52), R38 (≠ K53), R39 (≠ D54), V72 (≠ A98), S73 (≠ T99), S74 (≠ F100), T100 (= T126), K102 (= K128), G127 (= G153), S131 (= S157), E185 (= E212), G280 (= G325), A284 (≠ T329)
5x9dA Crystal structure of homoserine dehydrogenase in complex with l- cysteine and NAD (see paper)
33% identity, 96% coverage: 5:338/349 of query aligns to 2:295/302 of 5x9dA
- active site: D196 (= D223), K200 (= K227)
- binding (2R)-3-[[(4S)-3-aminocarbonyl-1-[(2R,3R,4S,5R)-5-[[[[(2R,3S,4R,5R)-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxymethyl]-3,4-bis(oxidanyl)oxolan-2-yl]-4H-pyridin-4-yl]sulfanyl]-2-azanyl-propanoic acid: F6 (≠ L9), G7 (= G10), Y8 (≠ F11), G9 (= G12), N10 (≠ G13), V11 (= V14), T37 (≠ N52), R38 (≠ K53), V72 (≠ A98), S73 (≠ T99), S74 (≠ F100), P82 (= P108), T100 (= T126), N101 (= N127), K102 (= K128), G127 (= G153), S131 (= S157), N155 (= N182), G156 (= G183), T157 (= T184), Y183 (= Y210), A184 (= A211), E185 (= E212), D191 (= D218), D196 (= D223), K200 (= K227), A281 (= A324), G282 (= G325), A286 (≠ T329)
Q5F8J4 NAD(+)-dependent homoserine dehydrogenase; NAD(+)-dependent HSD; NgHSD; EC 1.1.1.3 from Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) (see paper)
39% identity, 64% coverage: 116:340/349 of query aligns to 92:316/435 of Q5F8J4
Sites not aligning to the query:
- 45 L→R: Shows a marked increase in the catalytic efficiency with NADP(+).
- 45:46 LS→RD: Does not impair the catalytic activity with NAD(+). Slightly increases the activity, but slightly decreases the affinity for NADP(+).; LS→RR: Causes a shift in coenzyme preference from NAD(+) to NADP(+) by a factor of 974. Shows a slight decrease in the catalytic efficiency with NAD(+) and a 4.5-fold increase in catalytic efficiency with NADP(+).
4pg7A Crystal structure of s. Aureus homoserine dehydrogenase at ph7.5 (see paper)
33% identity, 96% coverage: 6:340/349 of query aligns to 7:306/402 of 4pg7A
Sites not aligning to the query:
4xb2A Hyperthermophilic archaeal homoserine dehydrogenase mutant in complex with NADPH (see paper)
32% identity, 95% coverage: 6:338/349 of query aligns to 5:309/319 of 4xb2A
- active site: D211 (= D223), K215 (= K227)
- binding l-homoserine: A171 (≠ G183), S172 (≠ T184), D206 (= D218), K215 (= K227)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: F8 (≠ L9), F10 (= F11), G11 (= G12), T12 (≠ G13), V13 (= V14), R40 (≠ L45), V91 (vs. gap), S92 (vs. gap), S93 (vs. gap), S114 (≠ T126), N115 (= N127), K116 (= K128), S141 (≠ G153), G295 (≠ A324), T300 (= T329)
6a0tB Homoserine dehydrogenase k99a mutant from thermus thermophilus hb8 complexed with hse and NADP+ (see paper)
34% identity, 96% coverage: 5:340/349 of query aligns to 5:305/332 of 6a0tB
- active site: D191 (= D223), K195 (= K227)
- binding l-homoserine: N150 (= N182), G151 (= G183), T152 (= T184), Y178 (= Y210), E180 (= E212), D186 (= D218), K195 (= K227)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G10 (= G10), G11 (≠ F11), G12 (= G12), T13 (≠ G13), V14 (= V14), L42 (≠ I50), V43 (≠ I51), R44 (≠ N52), D45 (= D57), K48 (≠ E60), R50 (≠ A62), A73 (= A98), M74 (≠ V104), G75 (≠ D105), A97 (≠ T126), N98 (= N127), G177 (= G209), E180 (= E212), A289 (= A324), G290 (= G325), T294 (= T329)
6a0sA Homoserine dehydrogenase from thermus thermophilus hb8 complexed with hse and NADPH (see paper)
34% identity, 96% coverage: 5:340/349 of query aligns to 5:305/331 of 6a0sA
- active site: D191 (= D223), K195 (= K227)
- binding l-homoserine: K99 (= K128), N150 (= N182), G151 (= G183), T152 (= T184), Y178 (= Y210), E180 (= E212), D186 (= D218), K195 (= K227)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G11 (≠ F11), G12 (= G12), T13 (≠ G13), V14 (= V14), L42 (≠ I50), V43 (≠ I51), R44 (≠ N52), D45 (= D57), K48 (≠ E60), R50 (≠ A62), A73 (= A98), M74 (≠ V104), A97 (≠ T126), K99 (= K128), G177 (= G209), E180 (= E212), A289 (= A324), G290 (= G325), T294 (= T329)
2ejwA Homoserine dehydrogenase from thermus thermophilus hb8
34% identity, 96% coverage: 5:340/349 of query aligns to 5:305/331 of 2ejwA
4xb1A Hyperthermophilic archaeal homoserine dehydrogenase in complex with NADPH (see paper)
31% identity, 95% coverage: 6:338/349 of query aligns to 5:309/319 of 4xb1A
- active site: D211 (= D223), K215 (= K227)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: F8 (≠ L9), F10 (= F11), G11 (= G12), T12 (≠ G13), V13 (= V14), D39 (= D44), R40 (≠ L45), K57 (≠ P65), V91 (vs. gap), S92 (vs. gap), S93 (vs. gap), S114 (≠ T126), K116 (= K128), S141 (≠ G153), G295 (≠ A324), T300 (= T329)
3ingA Crystal structure of homoserine dehydrogenase (np_394635.1) from thermoplasma acidophilum at 1.95 a resolution
27% identity, 96% coverage: 3:338/349 of query aligns to 2:314/319 of 3ingA
- active site: D209 (= D223), K213 (= K227)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G9 (= G10), T10 (≠ F11), G11 (= G12), N12 (≠ G13), V13 (= V14), D38 (= D44), S39 (≠ L45), K57 (≠ P65), C85 (≠ A98), T86 (= T99), P87 (≠ F100), A112 (≠ T126), N113 (= N127), K114 (= K128), A139 (≠ G153), E198 (= E212), S199 (≠ A213), P302 (≠ R326), T305 (= T329)
3jsaA Homoserine dehydrogenase from thermoplasma volcanium complexed with NAD
28% identity, 95% coverage: 6:338/349 of query aligns to 6:317/321 of 3jsaA
- active site: D212 (= D223), K216 (= K227)
- binding nicotinamide-adenine-dinucleotide: G10 (= G10), L11 (≠ F11), G12 (= G12), N13 (≠ G13), V14 (= V14), D42 (= D44), S43 (≠ L45), A90 (= A98), T91 (= T99), P92 (≠ T101), A117 (≠ T126), N118 (= N127), A144 (≠ G153), T308 (= T329)
O81852 Bifunctional aspartokinase/homoserine dehydrogenase 2, chloroplastic; AK-HD 2; AK-HSDH 2; Beta-aspartyl phosphate homoserine 2; EC 2.7.2.4; EC 1.1.1.3 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
26% identity, 68% coverage: 105:343/349 of query aligns to 651:911/916 of O81852
Sites not aligning to the query:
- 441 I→A: Loss of threonine sensitivity for the aspartokinase activity and decreased inhibition of homoserine dehydrogenase activity by threonine.
- 443 Q→A: Loss of threonine sensitivity for the aspartokinase activity and decreased inhibition of homoserine dehydrogenase activity by threonine.
- 522 I→A: No effect on the inhibition of aspartokinase activity by threonine, but decreased inhibition of homoserine dehydrogenase activity by threonine.
- 524 Q→A: No effect on the inhibition of aspartokinase activity by threonine, but decreased inhibition of homoserine dehydrogenase activity by threonine.
P31116 Homoserine dehydrogenase; HDH; EC 1.1.1.3 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
31% identity, 34% coverage: 112:231/349 of query aligns to 101:227/359 of P31116
- K117 (= K128) binding
- E208 (= E212) binding ; mutation to D: Increases KM for aspartate-semialdehyde 48-fold and reduces kcat by 50%.; mutation E->L,Q: Loss of activity.
- D219 (= D223) mutation to L: Reduces kcat 150-fold.
- K223 (= K227) mutation to V: Loss of activity.
Sites not aligning to the query:
1tveA Homoserine dehydrogenase in complex with 4-(4-hydroxy-3- isopropylphenylthio)-2-isopropylphenol (see paper)
31% identity, 34% coverage: 112:231/349 of query aligns to 100:226/358 of 1tveA
Sites not aligning to the query:
1q7gA Homoserine dehydrogenase in complex with suicide inhibitor complex NAD-5-hydroxy-4-oxonorvaline (see paper)
31% identity, 34% coverage: 112:231/349 of query aligns to 100:226/358 of 1q7gA
Sites not aligning to the query:
1ebuD Homoserine dehydrogenase complex with NAD analogue and l-homoserine (see paper)
31% identity, 34% coverage: 112:231/349 of query aligns to 100:226/358 of 1ebuD
Sites not aligning to the query:
1ebfA Homoserine dehydrogenase from s. Cerevisiae complex with NAD+ (see paper)
31% identity, 34% coverage: 112:231/349 of query aligns to 100:226/358 of 1ebfA
Sites not aligning to the query:
O94671 Probable homoserine dehydrogenase; HDH; EC 1.1.1.3 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
32% identity, 36% coverage: 109:232/349 of query aligns to 105:236/376 of O94671
- S201 (≠ D197) modified: Phosphoserine
Query Sequence
>AO356_27140 FitnessBrowser__pseudo5_N2C3_1:AO356_27140
VTEYKIALLGFGGVNRALTQLIADKNSRWADELGFTLKIVGVSDLYLGSIINKDGLDAHE
LAAVPAAKGGFRTLPGGSAEPANETVIRFSGADIVAEATFTNPVDGEPATTFCRWALEKG
VSVVTTNKGPVALHAQSLKTLADSAGARFEFEGSVMSGTPVIRLAKESLAGSEITGFKGI
LNGTSNFVLSSMETGLDFSSAVAKAQELGYAEADPTADVEGHDVRLKVVILANELLGAKL
KPSDVLCKGISEITAKDIAEATKVNARWKLIGSAEKRSDGSISASVSPQLLPSSDALSAV
SGATNAITFSTAILGPVTVVGAGAGRFETAFALLADIVSIHNHKTTSGK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory