Comparing AO356_27150 FitnessBrowser__pseudo5_N2C3_1:AO356_27150 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
4f4fA X-ray crystal structure of plp bound threonine synthase from brucella melitensis
39% identity, 89% coverage: 1:414/467 of query aligns to 2:415/464 of 4f4fA
1kl7A Crystal structure of threonine synthase from yeast (see paper)
31% identity, 90% coverage: 3:422/467 of query aligns to 7:459/509 of 1kl7A
Q42598 Threonine synthase; TS; EC 4.2.3.1 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
29% identity, 90% coverage: 1:420/467 of query aligns to 5:460/514 of Q42598
8g1yA Crystal structure of the threonine synthase from streptococcus pneumoniae in complex with pyridoxal 5-phosphate.
29% identity, 83% coverage: 3:389/467 of query aligns to 7:404/496 of 8g1yA
Sites not aligning to the query:
1vb3A Crystal structure of threonine synthase from escherichia coli
29% identity, 89% coverage: 1:415/467 of query aligns to 1:382/428 of 1vb3A
>AO356_27150 FitnessBrowser__pseudo5_N2C3_1:AO356_27150
MKYVSTRTPGRTFEFSEVLMGSYAPDGGLYVPRKVPRFKKEELSKLEWLPFHELARHVIE
PFLGGWVEQDQLSRMLEDTFDCFTNNAVAPLYQTASNEWLLELFHGPSGAYQDFGLQLMS
RFINHDLLKSGKKALIVGCTGGDTGAAAIKAFSGMTGVTLLVLHPSKELTAEDRRRLLSV
EEGNVINIEIAGDYSDCHRLCEQFLKQNNDAQQHLVSFNSVHWVRVLAHLSFYFYSALQL
GAPKRQVAFSVPTGNFGALYAGYIAKQMGLPIRQLIVATNANAGLHHFLQSNLYSRNEIR
TTKTPTMNVSLASNFERLQWSILNRCGEKVARNMQLLEGEGTIHLEQDEWLEARKLFDSL
AVDDADAFSCIHEVFAQSGYLVSPNTAIGLRAARVSRRSLLIPMISLATTHPSKIGAATD
KSEIFGHLNTGGAPASTEQDCTSIPNDIGALTSLVRALSKDTESHSL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory