Comparing AO356_27230 FitnessBrowser__pseudo5_N2C3_1:AO356_27230 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4uoxA Crystal structure of ygjg in complex with pyridoxal-5'-phosphate and putrescine (see paper)
40% identity, 48% coverage: 7:424/871 of query aligns to 33:443/453 of 4uoxA
P42588 Putrescine aminotransferase; PAT; PATase; Cadaverine transaminase; Diamine transaminase; Putrescine transaminase; Putrescine--2-oxoglutaric acid transaminase; Putrescine:2-OG aminotransferase; EC 2.6.1.82; EC 2.6.1.29 from Escherichia coli (strain K12) (see paper)
40% identity, 48% coverage: 7:424/871 of query aligns to 39:449/459 of P42588
4uoxC Crystal structure of ygjg in complex with pyridoxal-5'-phosphate and putrescine (see paper)
40% identity, 48% coverage: 7:424/871 of query aligns to 37:447/456 of 4uoxC
4ppmA Crystal structure of pige: a transaminase involved in the biosynthesis of 2-methyl-3-n-amyl-pyrrole (map) from serratia sp. Fs14 (see paper)
36% identity, 48% coverage: 2:421/871 of query aligns to 19:451/464 of 4ppmA
A0A0J9X1Q5 Aminotransferase PigE; EC 2.6.1.- from Serratia sp. (strain FS14) (see paper)
35% identity, 48% coverage: 2:421/871 of query aligns to 390:842/853 of A0A0J9X1Q5
2ordA Crystal structure of acetylornithine aminotransferase (ec 2.6.1.11) (acoat) (tm1785) from thermotoga maritima at 1.40 a resolution
35% identity, 46% coverage: 30:427/871 of query aligns to 21:393/393 of 2ordA
Q9X2A5 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
35% identity, 46% coverage: 30:427/871 of query aligns to 13:385/385 of Q9X2A5
Q5SHH5 [LysW]-aminoadipate semialdehyde transaminase; EC 2.6.1.118 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
35% identity, 46% coverage: 28:424/871 of query aligns to 28:394/395 of Q5SHH5
1wkhA Acetylornithine aminotransferase from thermus thermophilus hb8
35% identity, 46% coverage: 28:424/871 of query aligns to 20:386/387 of 1wkhA
Sites not aligning to the query:
1wkgA Acetylornithine aminotransferase from thermus thermophilus hb8
35% identity, 46% coverage: 28:424/871 of query aligns to 20:386/387 of 1wkgA
Sites not aligning to the query:
1vefA Acetylornithine aminotransferase from thermus thermophilus hb8
35% identity, 46% coverage: 28:424/871 of query aligns to 20:386/387 of 1vefA
Sites not aligning to the query:
2eh6A Crystal structure of acetylornithine aminotransferase from aquifex aeolicus vf5
38% identity, 38% coverage: 31:357/871 of query aligns to 14:332/375 of 2eh6A
Sites not aligning to the query:
Q9M8M7 Acetylornithine aminotransferase, chloroplastic/mitochondrial; ACOAT; Acetylornithine transaminase; AOTA; Protein HOPW1-1-INTERACTING 1; EC 2.6.1.11 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
36% identity, 45% coverage: 34:424/871 of query aligns to 83:453/457 of Q9M8M7
Sites not aligning to the query:
O66442 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Aquifex aeolicus (strain VF5)
38% identity, 38% coverage: 31:357/871 of query aligns to 15:333/376 of O66442
2eo5A Crystal structure of 4-aminobutyrate aminotransferase from sulfolobus tokodaii strain7
32% identity, 45% coverage: 33:427/871 of query aligns to 30:412/412 of 2eo5A
Sites not aligning to the query:
8ht4B Crystal structure of acetylornithine aminotransferase complex with plp from corynebacterium glutamicum
33% identity, 45% coverage: 31:424/871 of query aligns to 21:389/390 of 8ht4B
6io1B Crystal structure of a novel thermostable (s)-enantioselective omega- transaminase from thermomicrobium roseum (see paper)
34% identity, 47% coverage: 12:424/871 of query aligns to 15:443/448 of 6io1B
A0QYS9 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
35% identity, 46% coverage: 30:429/871 of query aligns to 21:388/390 of A0QYS9
P9WPZ7 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
35% identity, 48% coverage: 3:424/871 of query aligns to 14:393/400 of P9WPZ7
Sites not aligning to the query:
7nncC Crystal structure of mycobacterium tuberculosis argd with prosthetic group pyridoxal-5'-phosphate and 6-methoxyquinoline-3-carboxylic acid
35% identity, 48% coverage: 3:424/871 of query aligns to 8:387/391 of 7nncC
>AO356_27230 FitnessBrowser__pseudo5_N2C3_1:AO356_27230
MSRWQQISPFEQHVNPAVGELIRRVGLDKTFVRGEGCYLYDAQGRAYLDFLGAYGALPFG
HSPDALLAELASFQLSREPIFVQPSSLAASGLLAQRLLAIAPGDYRSVTFQNSGAETVEA
ALKACLIKTGRKRILSTHQSFHGKTLGALSATGSDKYQEGFQAPLPGFDFVDYGDIQALE
DQLQRHPDAYAAVIIEPVQGEGGINLPPPEYLQQIRAACDRSGTLLIIDEVQTGLGRTGQ
MFASAGVQADCLLLAKALGGGVMPIGACLISKNAYSEDFQNKHSSTFGGNTLACRIGLKV
LDLLDERQDLLDSVRDNGRYLLEQLNELAARHASFIKEVRGAGYLIGIEFDLDRSHYPQF
YGGFTGIMGEQESLVPILASYLLNVEGVRVAPTLNGANVMRVEPPLIAGRAECEVFIQAL
ARTLQWVEEGRTGTLLAHLLDAQPCSSGPPPAPLHQISFTEAVPDNHFAFVLHPLELSNY
AEFDESLSHYSQQSLRMLEERLNPLMDPFFVSTVELTSPATGRRVTGDLIMVPRSAAQFA
AMPIEESCELIGQAIDMAKQRGATLVGLGGHTSIVTGGGLRLLDKGVALTTGNSYTLLTA
VEASCRAVEMTGRRMQDMRVAVIGATGSIGSAIARLIAMQAGQVTLVGNPMSARFNTPRF
ASVITQLVSFCTQGVPAPGSVLAGIAERLNEHDSADLAALLLTENGERTALRWSNDINLS
LADADLVLIATNSAERFISADDIAEGAILCDISRPANVSQDISSRRPDVLVLDGGIVEMP
GEARLGSRYGIPQDLAYACMAETMMLALEGISCHTSLGLDLSNDDLELVQSLSVRHGFML
AGFRSFDKALDPDQWRRYAERFSTATAVETI
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory