SitesBLAST
Comparing AO356_27270 AO356_27270 MFS transporter to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
A0A0H2VG78 Glucose transporter GlcP; Glucose/H(+) symporter from Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) (see paper)
35% identity, 90% coverage: 44:470/472 of query aligns to 21:437/446 of A0A0H2VG78
- D22 (= D45) mutation to N: Affects symport activity. May function as an uniporter.
- R102 (= R125) mutation to A: Loss of transport activity.
- I105 (≠ L128) mutation to S: Affects symport activity. May function as an uniporter.
- E122 (= E145) mutation to A: Loss of transport activity.
- Q137 (≠ E160) mutation to A: Loss of transport activity.
- Q250 (≠ S282) mutation to A: Loss of transport activity.
- Q251 (= Q283) mutation to A: Loss of transport activity.
- N256 (= N288) mutation to A: Loss of transport activity.
- W357 (= W390) mutation to A: Loss of transport activity.
Q8VZR6 Inositol transporter 1 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
36% identity, 96% coverage: 19:472/472 of query aligns to 19:485/509 of Q8VZR6
- ER 481:482 (≠ -R 469) mutation to AA: No effect on targeting.
Sites not aligning to the query:
- 479:509 mutation Missing: Leads to endoplasmic reticulum relocalization.
- 500:509 mutation Missing: Leads to endoplasmic reticulum relocalization.
- 502:504 mutation LLE->AAA,SSS: Leads to plasma membrane relocalization.
P0AGF4 D-xylose-proton symporter; D-xylose transporter from Escherichia coli (strain K12) (see paper)
31% identity, 94% coverage: 25:467/472 of query aligns to 7:475/491 of P0AGF4
- F24 (= F42) mutation to A: Decreases xylose transport.
- G83 (= G93) mutation to A: Abolishes xylose transport.
- R133 (= R125) mutation R->C,H,L: Abolishes xylose transport.
- E153 (= E145) mutation to A: Abolishes xylose transport.
- R160 (= R152) mutation to A: Abolishes xylose transport.
- Q168 (≠ E160) binding ; mutation to A: Abolishes xylose transport.
- Q288 (≠ S282) mutation to A: Abolishes xylose transport.
- QQ 288:289 (≠ SQ 282:283) binding
- Q289 (= Q283) mutation to A: Strongly decreases xylose transport.
- N294 (= N288) binding ; mutation to A: Abolishes xylose transport.
- Y298 (= Y292) mutation to A: Abolishes xylose transport.
- N325 (≠ S319) mutation to A: No effect on xylose transport.
- G340 (= G334) mutation to A: Abolishes xylose transport.
- R341 (= R335) mutation R->A,W: Abolishes xylose transport.
- W392 (= W390) binding ; mutation to A: Abolishes xylose transport.
- E397 (= E395) mutation to A: Abolishes xylose transport.
- R404 (= R402) mutation to A: Strongly decreases xylose transport.
- Q415 (≠ F413) binding
- W416 (= W414) mutation to A: Strongly decreases xylose transport.
4gc0A The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to 6-bromo-6-deoxy-d-glucose (see paper)
31% identity, 94% coverage: 25:467/472 of query aligns to 3:471/475 of 4gc0A
4gbzA The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-glucose (see paper)
31% identity, 94% coverage: 25:467/472 of query aligns to 3:471/475 of 4gbzA
4gbyA The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-xylose (see paper)
31% identity, 94% coverage: 25:467/472 of query aligns to 3:471/475 of 4gbyA
Q9C757 Probable inositol transporter 2 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
34% identity, 69% coverage: 27:350/472 of query aligns to 27:355/580 of Q9C757
Sites not aligning to the query:
- 399 C→A: Strongly decreased nickel inhibition; when associated with A-402, A-410 and A-413.; C→S: No effect on inostol transport or nickel inhibition. No effect on inostol transport or nickel inhibition; when associated with S-410.
- 402 C→A: Strongly decreased nickel inhibition; when associated with A-399, A-410 and A-413.
- 410 C→A: Strongly decreased nickel inhibition; when associated with A-399, A-402 and A-413.; C→S: No effect on inostol transport or nickel inhibition; when associated with S-399.
- 413 C→A: Strongly decreased nickel inhibition; when associated with A-399, A-402 and A-410.
O23492 Inositol transporter 4; Myo-inositol-proton symporter INT4; Protein INOSITOL TRANSPORTER 4 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
34% identity, 70% coverage: 27:356/472 of query aligns to 26:363/582 of O23492
Sites not aligning to the query:
- 559:561 LLE→AAA: No effect on targeting.
- 559:582 mutation Missing: No effect on targeting.
- 564:565 FK→AA: No effect on targeting.
- 570:575 RRREKK→AAAAAA: No effect on targeting.
P39004 High-affinity hexose transporter HXT7 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
29% identity, 99% coverage: 3:467/472 of query aligns to 39:525/570 of P39004
Sites not aligning to the query:
- 560 modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
P39003 High-affinity hexose transporter HXT6 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
29% identity, 99% coverage: 3:467/472 of query aligns to 39:525/570 of P39003
Sites not aligning to the query:
- 560 modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
Q9P3U7 Probable high-affinity hexose transporter ght8, mitochondrial; Hexose transporter 8 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
28% identity, 92% coverage: 36:468/472 of query aligns to 14:465/547 of Q9P3U7
Sites not aligning to the query:
- 519 modified: Phosphoserine
- 523 modified: Phosphothreonine
- 526 modified: Phosphothreonine
- 527 modified: Phosphoserine
- 528 modified: Phosphoserine
- 529 modified: Phosphoserine
- 537 modified: Phosphoserine
O74969 High-affinity glucose transporter ght2; Hexose transporter 2 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
28% identity, 92% coverage: 36:468/472 of query aligns to 18:469/531 of O74969
Sites not aligning to the query:
- 507 modified: Phosphoserine
- 515 modified: Phosphoserine
- 519 modified: Phosphoserine
- 520 modified: Phosphoserine
- 523 modified: Phosphotyrosine
4zw9A Crystal structure of human glut3 bound to d-glucose in the outward- occluded conformation at 1.5 angstrom (see paper)
28% identity, 93% coverage: 34:472/472 of query aligns to 16:467/470 of 4zw9A
- binding beta-D-glucopyranose: Q159 (≠ E160), I166 (≠ Q167), Q280 (≠ S282), Q281 (= Q283), N286 (= N288), F377 (≠ M381), W386 (= W390)
- binding alpha-D-glucopyranose: Q159 (≠ E160), I162 (= I163), I166 (≠ Q167), Q280 (≠ S282), Q281 (= Q283), N286 (= N288), W386 (= W390)
7crzA Crystal structure of human glucose transporter glut3 bound with c3361 (see paper)
28% identity, 93% coverage: 34:472/472 of query aligns to 14:465/469 of 7crzA
- binding (2S,3R,4S,5R,6R)-6-(hydroxymethyl)-4-undec-10-enoxy-oxane-2,3,5-triol: T26 (= T46), A66 (vs. gap), S69 (≠ L75), Q157 (≠ E160), I164 (≠ Q167), Q278 (≠ S282), Q279 (= Q283), N284 (= N288), N313 (≠ S319), F375 (≠ M381), W384 (= W390), N411 (= N417), F412 (≠ V418), G415 (= G421)
P11169 Solute carrier family 2, facilitated glucose transporter member 3; Glucose transporter type 3, brain; GLUT-3 from Homo sapiens (Human) (see paper)
28% identity, 93% coverage: 34:472/472 of query aligns to 16:467/496 of P11169
- Q159 (≠ E160) binding
- QLS 277:279 (≠ AVT 279:281) Important for selectivity against fructose; mutation to HVA: Confers moderate fructose transport activity.
- QQ 280:281 (≠ SQ 282:283) binding
- N286 (= N288) binding
- N315 (≠ S319) binding
- E378 (≠ Q382) binding
- W386 (= W390) binding
7spsA Crystal structure of human glucose transporter glut3 bound with exofacial inhibitor sa47 (see paper)
28% identity, 93% coverage: 34:472/472 of query aligns to 13:464/468 of 7spsA
- binding methyl N-[(2-{4-[4-(5-fluoro-2-methoxyphenyl)piperazin-1-yl]-1H-pyrazolo[3,4-d]pyrimidin-1-yl}phenyl)methyl]-beta-alaninate: F21 (= F42), T25 (= T46), N29 (= N50), Q156 (≠ E160), I163 (≠ Q167), Q278 (= Q283), F286 (≠ M291), A308 (≠ N315), N312 (≠ S319), F374 (≠ M381), E375 (≠ Q382), N406 (≠ F413), W407 (= W414), N410 (= N417)
P78831 High-affinity glucose transporter ght5; Hexose transporter 5 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
28% identity, 92% coverage: 36:468/472 of query aligns to 14:465/546 of P78831
Sites not aligning to the query:
- 528 modified: Phosphoserine
- 537 modified: Phosphoserine
7sptA Crystal structure of exofacial state human glucose transporter glut3 (see paper)
28% identity, 93% coverage: 34:472/472 of query aligns to 16:467/470 of 7sptA
P32467 Low-affinity glucose transporter HXT4; Low-affinity glucose transporter LGT1 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
28% identity, 99% coverage: 3:467/472 of query aligns to 44:531/576 of P32467
- K45 (≠ N4) modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
W7MAT5 Myo-inositol transporter FST1 from Gibberella moniliformis (strain M3125 / FGSC 7600) (Maize ear and stalk rot fungus) (Fusarium verticillioides) (see paper)
29% identity, 93% coverage: 29:467/472 of query aligns to 73:523/574 of W7MAT5
- IRG 276:278 (≠ V-- 232) mutation Missing: Abolishes transporter activity. Abolishes synthesis of the polyketide mycotoxin fumonisin B1 (FB1), severely decreases macroconidia production.
- R277 (vs. gap) mutation R->G,K: Abolishes production of the polyketide mycotoxin fumonisin B1 (FB1), severely decreases macroconidia production.
- VVS 295:297 (≠ --A 240) mutation Missing: Abolishes transporter activity. Abolishes synthesis of the polyketide mycotoxin fumonisin B1 (FB1), severely decreases macroconidia production, results in hydrogen peroxide sensitivity, and decreases virulence in maize kernels.
- EEI 520:522 (= EEI 464:466) mutation Missing: Abolishes transporter activity. Abolishes synthesis of the polyketide mycotoxin fumonisin B1 (FB1), severely decreases macroconidia production.
Sites not aligning to the query:
- 546:548 mutation Missing: Abolishes transporter activity. Strongly decreases synthesis of the polyketide mycotoxin fumonisin B1 (FB1), severely decreases macroconidia production, results in hydrogen peroxide sensitivity, and decreases virulence in maize kernels.
- 547 L→D: Decreases transporter activity. Moderately decreases synthesis of the polyketide mycotoxin fumonisin B1 (FB1).
Query Sequence
>AO356_27270 AO356_27270 MFS transporter
MTINSYGNTADTSATFVSPEKHQAQRYLQKITWIATFGGLLFGFDTGVINGALLYMKDDL
GLTPFTEGLVASALLIGAMMGALFSGRLSDLKGRRRIILFLAVVFFLGALACALAPTLNV
MVAARFTLGLAVGGASVVVPAYLAEMAPSSIRGRIITRNELMIVTGQFLAFTTNATLGNL
FSDLDGVWRWMLALATLPAVALWLGMLYMPESPRWLATKGRFREGLEVLKLVREEYYAKA
EMEAITQQISNERFIKKGGWRDLSQKGARRIFLIGIGIAVTSQLTGVNSIMYFGTQILTE
AGLEQRSALIANVVNGVISIGATFVGIALLDRVGRRPMMLLGFTGTTLSLLLIGLVSVFV
DPSVTRAMLILGAMAMFLASMQGLIGPAFWVLLAEIFPMRIRGGCMGMAIAAFWLTNVMI
GMFFPSLVATIGIGQTFFVFVGAGLLSLTFVAVWVPETRGSTLEEIEQRLYG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory