Comparing AO356_27435 FitnessBrowser__pseudo5_N2C3_1:AO356_27435 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8gstC Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Pyruvate bound-form) (see paper)
51% identity, 93% coverage: 2:277/297 of query aligns to 7:278/290 of 8gstC
8gsrA Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Apo-form) (see paper)
51% identity, 93% coverage: 2:277/297 of query aligns to 7:278/290 of 8gsrA
6v77B Crystal structure of a putative hpce protein from mycobacterium smegmatis
44% identity, 74% coverage: 58:278/297 of query aligns to 54:276/279 of 6v77B
6iymA Fumarylacetoacetate hydrolase (eafah) from psychrophilic exiguobacterium antarcticum (see paper)
38% identity, 92% coverage: 1:272/297 of query aligns to 2:269/277 of 6iymA
3r6oA Crystal structure of a probable 2-hydroxyhepta-2,4-diene-1, 7- dioateisomerase from mycobacterium abscessus (see paper)
34% identity, 92% coverage: 1:272/297 of query aligns to 3:255/265 of 3r6oA
8sutA Crystal structure of yisk from bacillus subtilis in complex with reaction product 4-hydroxy-2-oxoglutaric acid (see paper)
42% identity, 65% coverage: 72:265/297 of query aligns to 94:289/303 of 8sutA
8skyB Crystal structure of yisk from bacillus subtilis in complex with oxalate (see paper)
42% identity, 65% coverage: 72:265/297 of query aligns to 93:288/303 of 8skyB
6sbiA X-ray structure of murine fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate (see paper)
42% identity, 60% coverage: 72:248/297 of query aligns to 13:191/216 of 6sbiA
3qdfA Crystal structure of 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase from mycobacterium marinum (see paper)
41% identity, 73% coverage: 63:278/297 of query aligns to 56:248/252 of 3qdfA
6fogA X-ray structure of homo sapiens fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate at 1.94a resolution. (see paper)
38% identity, 67% coverage: 72:270/297 of query aligns to 14:207/218 of 6fogA
Sites not aligning to the query:
Q6P587 Acylpyruvase FAHD1, mitochondrial; Fumarylacetoacetate hydrolase domain-containing protein 1; FAH domain-containing protein 1; Oxaloacetate decarboxylase; OAA decarboxylase; YisK-like protein; EC 3.7.1.5; EC 4.1.1.112 from Homo sapiens (Human) (see 3 papers)
38% identity, 67% coverage: 72:270/297 of query aligns to 19:212/224 of Q6P587
6j5xB Crystal structure of fumarylpyruvate hydrolase from corynebacterium glutamicum in complex with mn2+ and pyruvate (see paper)
35% identity, 73% coverage: 56:271/297 of query aligns to 53:270/280 of 6j5xB
6j5xA Crystal structure of fumarylpyruvate hydrolase from corynebacterium glutamicum in complex with mn2+ and pyruvate (see paper)
35% identity, 73% coverage: 56:271/297 of query aligns to 53:270/280 of 6j5xA
1gttA Crystal structure of hpce (see paper)
40% identity, 59% coverage: 73:248/297 of query aligns to 225:392/421 of 1gttA
4dbhA Crystal structure of cg1458 with inhibitor (see paper)
35% identity, 59% coverage: 72:247/297 of query aligns to 63:243/269 of 4dbhA
3v77A Crystal structure of a putative fumarylacetoacetate isomerase/hydrolase from oleispira antarctica (see paper)
36% identity, 60% coverage: 72:248/297 of query aligns to 17:197/224 of 3v77A
6j5yA Crystal structure of fumarylpyruvate hydrolase from pseudomonas aeruginosa in complex with mn2+ and pyruvate (see paper)
33% identity, 68% coverage: 70:272/297 of query aligns to 23:225/233 of 6j5yA
6jvwB Crystal structure of maleylpyruvate hydrolase from sphingobium sp. Syk-6 in complex with manganese (ii) ion and pyruvate (see paper)
35% identity, 70% coverage: 71:278/297 of query aligns to 76:261/264 of 6jvwB
1nkqA Crystal structure of yeast ynq8, a fumarylacetoacetate hydrolase family protein
30% identity, 59% coverage: 73:248/297 of query aligns to 11:210/247 of 1nkqA
3lzkC The crystal structure of a probably aromatic amino acid degradation protein from sinorhizobium meliloti 1021
28% identity, 54% coverage: 85:243/297 of query aligns to 106:270/343 of 3lzkC
Sites not aligning to the query:
>AO356_27435 FitnessBrowser__pseudo5_N2C3_1:AO356_27435
MRLVRFGLPGQEQPGILDSQGIVRDLSGIVDDIDASALSPSVLEKLRAVDVEKLPVVAPG
TRLGPCVGSVPNLICIGLNYSDHAAETNTPIPSQPVVFNKHTASISGPNDPVILPTGAQK
LDWEVELAIVIGTPAWQIDEARALDHVAGYCLANDVSERAYQLEYEGQWTKGKSGFSFAP
LGPWLVTRDEIADPQALDLWLDVNGKRFQTGNTRTMIFSVAHIVAYLSRFMPLLPGDVII
TGTPPGVGLGQKPPVFLKAGDTMRVGGQGLGEQFQTVVPYVAEMGAAWVAGRHPNVD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory