SitesBLAST
Comparing AO356_27475 FitnessBrowser__pseudo5_N2C3_1:AO356_27475 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4k28A 2.15 angstrom resolution crystal structure of a shikimate dehydrogenase family protein from pseudomonas putida kt2440 in complex with NAD+ (see paper)
33% identity, 95% coverage: 7:267/274 of query aligns to 2:266/266 of 4k28A
- binding manganese (ii) ion: C153 (≠ S158), C164 (≠ V169), V176 (= V180), F180 (≠ P184)
- binding nicotinamide-adenine-dinucleotide: I129 (= I134), G130 (= G135), G132 (= G137), G133 (= G138), V134 (≠ S139), C153 (≠ S158), D154 (= D159), P155 (≠ L160), R159 (= R164), S193 (≠ T197), P194 (= P198), V222 (≠ I223), G245 (= G246), M248 (= M249), A249 (≠ H250)
2hk9B Crystal structure of shikimate dehydrogenase from aquifex aeolicus in complex with shikimate and NADP+ at 2.2 angstrom resolution (see paper)
30% identity, 93% coverage: 5:259/274 of query aligns to 2:248/267 of 2hk9B
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V67 (≠ M71), G130 (= G135), G133 (= G138), A134 (≠ S139), N153 (≠ S158), R154 (= R164), T155 (≠ A165), K158 (≠ L168), T188 (= T197), S189 (≠ P198), V190 (≠ L199), I214 (= I223), M238 (= M249), L239 (≠ H250)
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: S19 (≠ A22), S21 (= S24), N64 (≠ L68), T66 (= T70), K70 (= K74), N91 (= N95), D106 (= D111), Y216 (≠ T225), L239 (≠ H250), Q242 (= Q253)
2hk9A Crystal structure of shikimate dehydrogenase from aquifex aeolicus in complex with shikimate and NADP+ at 2.2 angstrom resolution (see paper)
30% identity, 93% coverage: 5:259/274 of query aligns to 2:248/269 of 2hk9A
- binding 2'-monophosphoadenosine-5'-diphosphate: V67 (≠ M71), G132 (= G137), G133 (= G138), A134 (≠ S139), N153 (≠ S158), R154 (= R164), T155 (≠ A165), T188 (= T197), S189 (≠ P198), V190 (≠ L199)
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: S19 (≠ A22), S21 (= S24), N64 (≠ L68), K70 (= K74), N91 (= N95), D106 (= D111), Y216 (≠ T225), L239 (≠ H250), Q242 (= Q253)
3tozA 2.2 angstrom crystal structure of shikimate 5-dehydrogenase from listeria monocytogenes in complex with NAD.
31% identity, 99% coverage: 4:274/274 of query aligns to 8:289/291 of 3tozA
- binding nicotinamide-adenine-dinucleotide: G137 (= G135), A138 (= A136), G139 (= G137), G140 (= G138), A141 (≠ S139), N161 (vs. gap), R162 (vs. gap), D164 (= D159), F166 (≠ D161), T210 (= T197), G211 (≠ P198), V212 (≠ L199), M214 (= M201), F217 (≠ D204), V238 (≠ I223), Y240 (≠ T225), G261 (= G246), M264 (= M249), M265 (≠ H250)
Q8Y9N5 Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 from Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
31% identity, 99% coverage: 4:274/274 of query aligns to 8:289/291 of Q8Y9N5
3tnlA 1.45 angstrom crystal structure of shikimate 5-dehydrogenase from listeria monocytogenes in complex with shikimate and NAD.
31% identity, 99% coverage: 4:274/274 of query aligns to 5:286/288 of 3tnlA
- binding nicotinamide-adenine-dinucleotide: M71 (= M71), G134 (= G135), A135 (= A136), G136 (= G137), G137 (= G138), A138 (≠ S139), N158 (vs. gap), R159 (vs. gap), D161 (= D159), F163 (≠ D161), T207 (= T197), V209 (≠ L199), M211 (= M201), F214 (≠ D204), V235 (≠ I223), Y237 (≠ T225), M261 (= M249), M262 (≠ H250)
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: S23 (≠ A22), S25 (= S24), N68 (≠ L68), S70 (≠ T70), K74 (= K74), N95 (= N95), D110 (= D111), Q265 (= Q253)
O67049 Shikimate dehydrogenase (NADP(+)); SD; SDH; EC 1.1.1.25 from Aquifex aeolicus (strain VF5) (see paper)
30% identity, 93% coverage: 5:259/274 of query aligns to 2:248/269 of O67049
1npdB X-ray structure of shikimate dehydrogenase complexed with NAD+ from e.Coli (ydib) northeast structural genomics research consortium (nesg) target er24 (see paper)
29% identity, 99% coverage: 5:274/274 of query aligns to 3:283/288 of 1npdB
- binding nicotinamide-adenine-dinucleotide: A132 (= A136), G133 (= G137), G134 (= G138), A135 (≠ S139), N155 (≠ D159), R156 (≠ L160), D158 (≠ P162), F160 (vs. gap), T204 (= T197), K205 (≠ P198), V206 (≠ L199), M208 (= M201), C232 (≠ I223), M258 (= M249), L259 (≠ H250)
P0A6D5 Quinate/shikimate dehydrogenase; NAD-dependent shikimate 5-dehydrogenase; EC 1.1.1.282 from Escherichia coli (strain K12) (see 4 papers)
29% identity, 99% coverage: 5:274/274 of query aligns to 3:283/288 of P0A6D5
- S22 (= S24) mutation to A: Kinetically unchanged as compared with the wild-type.
- Y39 (≠ C41) mutation to F: Kinetically unchanged as compared with the wild-type.
- S67 (≠ T70) mutation to A: Reduces activity towards quinate about 6-fold, but has a little effect on shikimate conversion.
- K71 (= K74) mutation to A: 3200-fold decrease in the affinity for quinate. 170-fold decrease in the affinity for shikimate.; mutation to G: 10-fold greater reduction in catalytic efficiency is observed with quinate than with shikimate.
- N92 (= N95) mutation to A: Alters protein structure. Loss of activity for both substrates.
- T106 (≠ F110) mutation to A: 2000-fold decrease in the affinity for quinate. 70-fold decrease in the affinity for shikimate. 10-fold greater reduction in catalytic efficiency is observed with quinate than with shikimate.
- D107 (= D111) mutation to A: Loss of activity towards quinate. 20000-fold decrease in the affinity for shikimate.
- AGGA 132:135 (≠ AGGS 136:139) binding
- NRRD 155:158 (≠ DLDP 159:162) binding
- K205 (≠ P198) binding
- CVYN 232:235 (≠ IITR 223:226) binding
- G255 (= G246) binding
- Q262 (= Q253) mutation to A: 3-fold reduction in catalytic efficiency for both substrates.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
1o9bA Quinate/shikimate dehydrogenase ydib complexed with nadh (see paper)
29% identity, 97% coverage: 10:274/274 of query aligns to 2:277/280 of 1o9bA
- binding 1,4-dihydronicotinamide adenine dinucleotide: A126 (= A136), G127 (= G137), G128 (= G138), A129 (≠ S139), R150 (≠ L160), F154 (vs. gap), K199 (≠ P198), V200 (≠ L199), M202 (= M201), C226 (≠ I223), Y228 (≠ T225), M252 (= M249), L253 (≠ H250)
Q5HNV1 Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 from Staphylococcus epidermidis (strain ATCC 35984 / RP62A) (see paper)
27% identity, 93% coverage: 12:267/274 of query aligns to 3:251/269 of Q5HNV1
- SLS 13:15 (≠ AKS 22:24) binding
- T60 (= T70) binding
- N85 (= N95) binding
- D100 (= D111) binding
- Y211 (≠ T225) Plays a major role in the catalytic process and a minor role in the substrate binding; mutation to F: Leads to a 345-fold decrease in the catalytic efficiency and a 3-fold decrease in the affinity binding for shikimate.
- Q239 (= Q253) binding
Q58484 Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
31% identity, 93% coverage: 5:259/274 of query aligns to 2:260/282 of Q58484
1nvtB Crystal structure of shikimate dehydrogenase (aroe or mj1084) in complex with NADP+ (see paper)
31% identity, 93% coverage: 5:259/274 of query aligns to 7:265/287 of 1nvtB
- active site: K75 (= K74), D111 (= D111)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: I72 (≠ M71), G135 (= G135), G137 (= G137), G138 (= G138), A139 (≠ S139), N157 (≠ D159), R158 (≠ L160), T159 (≠ D161), K162 (≠ R164), A200 (= A196), T201 (= T197), P202 (= P198), I203 (≠ L199), M205 (= M201), L229 (≠ I223), Y231 (≠ T225), M255 (= M249), L256 (≠ H250)
- binding zinc ion: E22 (≠ R20), H23 (≠ S21)
1nvtA Crystal structure of shikimate dehydrogenase (aroe or mj1084) in complex with NADP+ (see paper)
31% identity, 93% coverage: 5:259/274 of query aligns to 7:265/287 of 1nvtA
- active site: K75 (= K74), D111 (= D111)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G135 (= G135), A139 (≠ S139), N157 (≠ D159), R158 (≠ L160), T159 (≠ D161), K162 (≠ R164), A200 (= A196), T201 (= T197), P202 (= P198), I203 (≠ L199), M205 (= M201), L229 (≠ I223), Y231 (≠ T225), G252 (= G246), M255 (= M249), L256 (≠ H250)
Q8ZPR4 Quinate/shikimate dehydrogenase; NAD-dependent shikimate 5-dehydrogenase; EC 1.1.1.282 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
31% identity, 91% coverage: 5:253/274 of query aligns to 3:262/288 of Q8ZPR4
3dooA Crystal structure of shikimate dehydrogenase from staphylococcus epidermidis complexed with shikimate (see paper)
26% identity, 93% coverage: 12:267/274 of query aligns to 3:242/258 of 3dooA
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: S13 (≠ A22), S15 (= S24), N58 (≠ L68), T60 (= T70), K64 (= K74), N85 (= N95), D100 (= D111), F227 (≠ H250), Q230 (= Q253)
2o7sA Crystal structure of the a. Thaliana dhq-dehydroshikimate-sdh- shikimate-NADP(h)
31% identity, 92% coverage: 4:254/274 of query aligns to 229:467/500 of 2o7sA
- binding 3-dehydroshikimate: I239 (≠ L14), S247 (≠ A22), S249 (= S24), T292 (= T70), K296 (= K74), N317 (= N95), D334 (= D111), Y438 (≠ T225), Q466 (= Q253)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: I293 (≠ M71), P294 (= P72), K296 (= K74), D334 (= D111), G354 (= G137), G355 (= G138), A356 (≠ S139), N374 (≠ D159), R375 (≠ L160), T376 (≠ D161), R379 (= R164), T409 (= T197), S410 (≠ P198), M411 (≠ L199), A436 (≠ I223), M462 (= M249), F463 (≠ H250)
Sites not aligning to the query:
Q9SQT8 Bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase, chloroplastic; DHQ-SDH protein; DHQase-SORase; Protein EMBRYO DEFECTIVE 3004; EC 4.2.1.10; EC 1.1.1.25 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
30% identity, 92% coverage: 4:254/274 of query aligns to 318:579/603 of Q9SQT8
- S336 (≠ A22) binding ; mutation to A: 13-fold decrease in substrate affinity but almost no change in activity.
- S338 (= S24) binding ; mutation to A: 10-fold decrease in activity, and 9-fold decrease in substrate affinity.
- T381 (= T70) binding
- K385 (= K74) binding ; mutation to A: Strongly reduced shikimate dehydrogenase activity, but minor change in substrate affinity.; mutation to N: Strongly reduced shikimate dehydrogenase activity, but no change in substrate affinity.
- N406 (= N95) binding
- D423 (= D111) binding ; mutation to A: Loss of shikimate dehydrogenase activity.; mutation to N: Reduced shikimate dehydrogenase activity, but no change in substrate affinity.
- A461 (= A136) binding
- G463 (= G138) binding
- A464 (≠ S139) binding
- N483 (≠ D159) binding
- T485 (≠ D161) binding
- R488 (= R164) binding
- M525 (= M201) binding
- A548 (≠ I223) binding
- Y550 (≠ T225) binding ; mutation Y->F,A: 100-fold decrease in activity, and 2-fold decrease in substrate affinity.
- G571 (= G246) binding
- Q578 (= Q253) binding
Sites not aligning to the query:
- 124 binding
- 126 binding
- 155 binding
- 241 binding
- 279 binding
- 300 binding
- 304 binding
- 582 binding
7colA Crystal structure of 5-ketofructose reductase complexed with NADPH (see paper)
34% identity, 84% coverage: 32:262/274 of query aligns to 28:262/280 of 7colA
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G128 (= G135), G130 (= G137), G131 (= G138), A132 (≠ S139), N152 (≠ D159), R153 (≠ L160), K157 (≠ R164), T195 (= T197), S196 (≠ P198), I197 (≠ L199), V222 (≠ I223), Q252 (= Q253)
2o7qA Crystal structure of the a. Thaliana dhq-dehydroshikimate-sdh- shikimate-NADP(h)
30% identity, 92% coverage: 4:254/274 of query aligns to 229:468/501 of 2o7qA
Sites not aligning to the query:
Query Sequence
>AO356_27475 FitnessBrowser__pseudo5_N2C3_1:AO356_27475
MHPRITGTTRIYGLIGDPLRSAKSPMLLNKLFAEAQADAVCIPLEIGTGDLVEFVKGVRA
VRNLSGLLVTMPHKQSMLDIVDELHPTARQIGAINVVRCDNDGRWVGAVFDGLGCVAGMQ
RHGISLVGKSVLLIGAGGSGRAIAFAVAAAGARSLVISDLDPQRASDLVHRVAKEGPCAV
YTGPADPAGHDIVINATPLGMNPDDPMPIDATRLDPATVVVDIITRSEPTALLLEAQSRG
CQTLDGQPMHVGQALLALSFLGFEDIERRYSTEL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory