SitesBLAST
Comparing AO356_27695 FitnessBrowser__pseudo5_N2C3_1:AO356_27695 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3i8bA The crystal structure of xylulose kinase from bifidobacterium adolescentis
34% identity, 90% coverage: 4:450/495 of query aligns to 3:474/506 of 3i8bA
P09099 Xylulose kinase; XK; Xylulokinase; 1-deoxy-D-xylulokinase; EC 2.7.1.17; EC 2.7.1.- from Escherichia coli (strain K12) (see paper)
36% identity, 84% coverage: 6:422/495 of query aligns to 1:409/484 of P09099
- D6 (= D11) mutation to A: Loss of activity.
- MH 77:78 (≠ QH 85:86) binding
- D233 (= D248) mutation to A: Loss of activity.
2itmA Crystal structure of the e. Coli xylulose kinase complexed with xylulose (see paper)
35% identity, 84% coverage: 6:422/495 of query aligns to 1:401/476 of 2itmA
3ll3A The crystal structure of ligand bound xylulose kinase from lactobacillus acidophilus
25% identity, 89% coverage: 5:444/495 of query aligns to 3:437/492 of 3ll3A
- binding adenosine-5'-triphosphate: G259 (= G269), T260 (≠ S270), G299 (= G298), P316 (≠ I315), L320 (= L319), G400 (= G407), G401 (= G408), F402 (≠ G409)
- binding 1-deoxy-d-xylulose-5-phosphate: H128 (≠ A135), N296 (≠ S295), E342 (= E349), A349 (≠ P355)
- binding d-xylulose: Q78 (= Q84), M79 (≠ Q85), H80 (= H86), D238 (= D248), R343 (= R350)
3ll3B The crystal structure of ligand bound xylulose kinase from lactobacillus acidophilus
25% identity, 89% coverage: 5:444/495 of query aligns to 2:435/490 of 3ll3B
- binding adenosine-5'-diphosphate: G258 (= G269), T259 (≠ S270), G298 (≠ T309), P314 (≠ A325), G399 (= G408), F400 (≠ G409), K402 (= K411)
- binding 1-deoxy-d-xylulose-5-phosphate: H127 (≠ A135), N295 (≠ M306), G338 (≠ N347), E340 (= E349), A347 (≠ P355)
3kzbA Crystal structure of xylulokinase from chromobacterium violaceum
28% identity, 91% coverage: 10:457/495 of query aligns to 9:463/498 of 3kzbA
O34154 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Enterococcus faecalis (strain ATCC 700802 / V583) (see 2 papers)
24% identity, 100% coverage: 1:493/495 of query aligns to 1:491/501 of O34154
- M1 (= M1) modified: Initiator methionine, Removed
- H231 (≠ A232) modified: Phosphohistidine; by HPr
O34153 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Enterococcus casseliflavus (Enterococcus flavescens) (see 3 papers)
23% identity, 100% coverage: 1:493/495 of query aligns to 1:492/506 of O34153
- R84 (≠ Q85) binding
- E85 (≠ H86) binding
- Y136 (≠ G137) binding
- H232 (= H233) modified: Phosphohistidine; by HPr; mutation to A: Loss of phosphorylation, no effect on activity.; mutation to E: Loss of phosphorylation, 2.5-fold reduced activity.; mutation to R: Loss of phosphorylation, 3.4-fold increased activity.
- D246 (= D248) binding
- Q247 (≠ N249) binding
3h3nX Glycerol kinase h232r with glycerol (see paper)
22% identity, 99% coverage: 2:493/495 of query aligns to 1:491/501 of 3h3nX
5ya2A Crystal structure of lsrk-hpr complex with adp (see paper)
24% identity, 94% coverage: 3:466/495 of query aligns to 1:459/478 of 5ya2A
5ya1A Crystal structure of lsrk-hpr complex with atp (see paper)
24% identity, 94% coverage: 3:466/495 of query aligns to 1:459/478 of 5ya1A
6k76A Glycerol kinase form thermococcus kodakarensis, complex structure with substrate.
24% identity, 96% coverage: 8:484/495 of query aligns to 2:477/485 of 6k76A
P0A6F3 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Escherichia coli (strain K12) (see 10 papers)
23% identity, 98% coverage: 1:487/495 of query aligns to 1:493/502 of P0A6F3
- M1 (= M1) modified: Initiator methionine, Removed
- T14 (= T14) binding ; binding
- R18 (≠ K18) binding
- S59 (≠ Q60) mutation to W: Abolishes inhibition of GK by FBP via disruption of the dimer-tetramer assembly reaction. Inhibition by EIIA-Glc is unchanged compared to wild type. The activity of this mutant is significantly higher than wild-type, and the Michaelis constants are increased slightly compared to wild-type.
- A66 (= A67) mutation to T: Although it completely abolishes FBP regulation and disrupts dimer-tetramer equilibrium, the crystal structure is essentially identical to the symmetric tetramer found in the FBP-bound form of the enzyme.
- R84 (≠ Q85) binding ; binding
- E85 (≠ H86) binding ; binding
- Y136 (≠ G137) binding ; binding
- G231 (= G235) mutation to D: Displays an increased enzymatic activity and a decreased allosteric regulation by FBP compared to wild-type. It displays a dimer form and is resistant to tetramer formation in the presence of FBP, whereas wild-type dimers are converted into inactive tetramers in the presence of FBP.
- K233 (≠ N237) modified: N6-malonyllysine
- G235 (≠ D239) binding
- R237 (≠ V241) binding ; mutation to A: Drastically reduces inhibition of GK by FBP and lowers, but did not eliminate, the ability of FBP to promote tetramer association.
- D246 (= D248) binding ; binding
- Q247 (≠ N249) binding
- T268 (≠ S270) binding
- G305 (≠ C304) mutation to S: In glpK22; abolishes glucose control of glycerol utilization.
- G311 (≠ N310) binding
- G412 (= G408) binding
- N416 (≠ S412) binding
- I475 (≠ S469) mutation to D: It decreases Vmax to about 10% of the wild-type value and the affinity for substrate is increased about two- to fourfold. This mutation decreases the catalytic activity in a manner that is analogous to that obtained upon EIIA-Glc binding. It increases the affinity for FBP about fivefold.
- E479 (≠ P473) binding
- R480 (≠ V474) mutation to D: It decreases Vmax to about 10% of the wild-type value and the affinity for substrate is increased about two- to fourfold. This mutation decreases the catalytic activity in a manner that is analogous to that obtained upon EIIA-Glc binding. Regulation by FBP is not affected by this substitution. No inhibition by EIIA-Glc is observed, which is consistent with a decrease in affinity for EIIA-Glc of about 250-fold.
1gllO Escherichia coli glycerol kinase mutant with bound atp analog showing substantial domain motion (see paper)
23% identity, 98% coverage: 4:487/495 of query aligns to 2:487/494 of 1gllO
- binding phosphomethylphosphonic acid adenylate ester: T12 (= T14), T13 (≠ Q15), G261 (= G269), T262 (≠ S270), G305 (≠ N310), I308 (vs. gap), Q309 (≠ G313), A321 (= A325), G406 (= G408), N410 (≠ S412)
- binding glycerol: R82 (≠ Q85), E83 (≠ H86), Y134 (≠ G137), D240 (= D248), Q241 (≠ N249), F265 (≠ T273)
1gljO Escherichia coli glycerol kinase mutant with bound atp analog showing substantial domain motion (see paper)
23% identity, 98% coverage: 4:487/495 of query aligns to 2:487/494 of 1gljO
- binding gamma-arsono-beta, gamma-methyleneadenosine-5'-diphosphate: T12 (= T14), T13 (≠ Q15), G261 (= G269), T262 (≠ S270), G305 (≠ N310), Q309 (≠ G313), A321 (= A325), G406 (= G408), A407 (≠ G409)
- binding glycerol: R82 (≠ Q85), E83 (≠ H86), W102 (= W104), Y134 (≠ G137), D240 (= D248), F265 (≠ T273)
1bwfO Escherichia coli glycerol kinase mutant with bound atp analog showing substantial domain motion (see paper)
23% identity, 98% coverage: 4:487/495 of query aligns to 2:487/494 of 1bwfO
- binding phosphodifluoromethylphosphonic acid-adenylate ester: T12 (= T14), T13 (≠ Q15), T262 (≠ S270), G305 (≠ N310), I308 (vs. gap), Q309 (≠ G313), A321 (= A325), G406 (= G408), N410 (≠ S412)
- binding glycerol: R82 (≠ Q85), E83 (≠ H86), W102 (= W104), Y134 (≠ G137), D240 (= D248), Q241 (≠ N249), F265 (≠ T273)
1gldG Cation promoted association (cpa) of a regulatory and target protein is controlled by phosphorylation (see paper)
23% identity, 98% coverage: 5:487/495 of query aligns to 1:482/489 of 1gldG
- binding adenosine-5'-diphosphate: R14 (≠ K18), G256 (= G269), T257 (≠ S270), G300 (≠ N310), A316 (= A325), G401 (= G408), A402 (≠ G409), N405 (≠ S412)
- binding glyceraldehyde-3-phosphate: T10 (= T14), R80 (≠ Q85), E81 (≠ H86), Y132 (≠ G137), D235 (= D248), F260 (≠ T273)
- binding manganese (ii) ion: D7 (= D11), R14 (≠ K18)
1glcG Cation promoted association (cpa) of a regulatory and target protein is controlled by phosphorylation (see paper)
23% identity, 98% coverage: 5:487/495 of query aligns to 1:482/489 of 1glcG
- binding adenosine-5'-diphosphate: G256 (= G269), T257 (≠ S270), G300 (≠ N310), A316 (= A325), G401 (= G408), A402 (≠ G409), N405 (≠ S412)
- binding glyceraldehyde-3-phosphate: T10 (= T14), R80 (≠ Q85), E81 (≠ H86), W100 (= W104), Y132 (≠ G137), D235 (= D248), F260 (≠ T273)
1glbG Structure of the regulatory complex of escherichia coli iiiglc with glycerol kinase (see paper)
23% identity, 98% coverage: 5:487/495 of query aligns to 1:482/489 of 1glbG
- binding adenosine-5'-diphosphate: R14 (≠ K18), G256 (= G269), T257 (≠ S270), G300 (≠ N310), I303 (vs. gap), A316 (= A325), G401 (= G408), A402 (≠ G409), N405 (≠ S412)
- binding glycerol: R80 (≠ Q85), E81 (≠ H86), W100 (= W104), Y132 (≠ G137), D235 (= D248), F260 (≠ T273)
6udeB Crystal structure of glycerol kinase from elizabethkingia anophelis nuhp1 in complex with adp and glycerol
23% identity, 98% coverage: 3:487/495 of query aligns to 1:488/495 of 6udeB
- binding adenosine-5'-diphosphate: R16 (≠ K18), G262 (= G269), T263 (≠ S270), G306 (≠ T312), I309 (= I315), S323 (≠ A328), G406 (= G407), G407 (= G408), A408 (≠ G409)
- binding magnesium ion: G11 (= G13), T12 (= T14), T13 (≠ Q15), S14 (≠ G16)
Query Sequence
>AO356_27695 FitnessBrowser__pseudo5_N2C3_1:AO356_27695
MANQQLFLGIDCGTQGTKALILDTISGQVLGQGAAAHSMISGANGRREQDTQQWLDAFTQ
ATHQALAAAGVDGQAILGIGVSGQQHGLVLLDDQGQVLRPAKLWCDTETTPENDRLLAYL
GGEDGSLERLGVVIAPGYTVSKLLWTREQHPQVFERIASVLLPHDFLNYWLTGRHCSEYG
DASGTGYFNVRTRQWDVQLLQHIDPSARLQAALPELIEAHQPVGRILPAIAAHLGINPDA
VVASGGGDNMMGAIGTGNIQPGVITMSLGSSGTVYAYAAEPAVSPQPSVATFCSSNGGWL
PLICTMNLTNATGAIRELLDLDIDAFNALVVQAPIGAEGVCMLPFLNGERVPALPHATAS
LLGLTTTNLTRANLCRAVVEGTTFGLRYGLDLLRANGLKAQSIRLIGGGSKSPVWRQIVA
DIMDTTVICTEQSEAAALGAAIQAAWCHSGAQDSLAELCERCVKLDPASETRPVTAHVTA
SQQAYERYRQHVATL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory