Comparing AO356_27700 FitnessBrowser__pseudo5_N2C3_1:AO356_27700 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4wjmA Crystal structure of fructokinase from brucella abortus 2308 with bound amppnp
33% identity, 100% coverage: 1:311/312 of query aligns to 7:312/312 of 4wjmA
7fcaD Pfkb(mycobacterium marinum) (see paper)
35% identity, 96% coverage: 3:302/312 of query aligns to 5:281/282 of 7fcaD
5eynA Crystal structure of fructokinase from vibrio cholerae o395 in fructose, adp, beryllium trifluoride and calcium ion bound form
29% identity, 88% coverage: 21:294/312 of query aligns to 16:300/306 of 5eynA
Sites not aligning to the query:
3ih0A Crystal structure of an uncharacterized sugar kinase ph1459 from pyrococcus horikoshii in complex with amp-pnp
28% identity, 98% coverage: 5:311/312 of query aligns to 6:293/304 of 3ih0A
3gbuA Crystal structure of an uncharacterized sugar kinase ph1459 from pyrococcus horikoshii in complex with atp
28% identity, 98% coverage: 5:311/312 of query aligns to 5:292/302 of 3gbuA
5yggA Crystal structure of fructokinase double-mutant (t261c-h108c) from vibrio cholerae o395 in fructose, adp and potassium ion bound form (see paper)
29% identity, 88% coverage: 21:294/312 of query aligns to 20:304/310 of 5yggA
Sites not aligning to the query:
Q8ZKR2 Aminoimidazole riboside kinase; AIRs kinase; EC 2.7.1.223 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
28% identity, 79% coverage: 21:268/312 of query aligns to 19:266/319 of Q8ZKR2
Sites not aligning to the query:
3iq0B Crystal structure of a putative ribokinase ii in complex with atp and mg+2 from e.Coli
27% identity, 76% coverage: 33:269/312 of query aligns to 36:267/308 of 3iq0B
Sites not aligning to the query:
1tz6A Crystal structure of aminoimidazole riboside kinase from salmonella enterica complexed with aminoimidazole riboside and atp analog (see paper)
27% identity, 93% coverage: 21:311/312 of query aligns to 15:292/297 of 1tz6A
Sites not aligning to the query:
1tz3A Crystal structure of aminoimidazole riboside kinase complexed with aminoimidazole riboside (see paper)
27% identity, 93% coverage: 21:311/312 of query aligns to 15:292/299 of 1tz3A
Sites not aligning to the query:
3lkiB Crystal structure of fructokinase with bound atp from xylella fastidiosa
27% identity, 96% coverage: 3:302/312 of query aligns to 6:302/322 of 3lkiB
8cqxA Ribokinase from t.Sp mutant a92g
26% identity, 92% coverage: 26:311/312 of query aligns to 30:294/300 of 8cqxA
1v1bA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound atp (see paper)
27% identity, 90% coverage: 32:311/312 of query aligns to 33:297/300 of 1v1bA
1v1aA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound 2- keto-3-deoxygluconate and adp (see paper)
27% identity, 90% coverage: 32:311/312 of query aligns to 33:297/301 of 1v1aA
Sites not aligning to the query:
6znxC Ribokinase from thermus species
28% identity, 92% coverage: 26:311/312 of query aligns to 17:259/265 of 6znxC
Q53W83 2-dehydro-3-deoxygluconokinase; 2-keto-3-deoxygluconokinase; 3-deoxy-2-oxo-D-gluconate kinase; KDG kinase; EC 2.7.1.45 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
29% identity, 74% coverage: 32:262/312 of query aligns to 33:259/309 of Q53W83
Sites not aligning to the query:
4xckA Vibrio cholerae o395 ribokinase complexed with adp, ribose and cesium ion. (see paper)
25% identity, 78% coverage: 26:267/312 of query aligns to 32:265/306 of 4xckA
Sites not aligning to the query:
6wk0B Crystal structure of human ribokinase in complex with amppcp and ribose
26% identity, 90% coverage: 32:311/312 of query aligns to 39:304/311 of 6wk0B
Sites not aligning to the query:
5c41A Crystal structure of human ribokinase in complex with amppcp in p21 spacegroup and with 4 protomers
26% identity, 90% coverage: 32:311/312 of query aligns to 39:304/317 of 5c41A
5c3yA Structure of human ribokinase crystallized with amppnp
26% identity, 90% coverage: 32:311/312 of query aligns to 38:303/306 of 5c3yA
>AO356_27700 FitnessBrowser__pseudo5_N2C3_1:AO356_27700
MYLVCGEALFDFFSEAEADGPASQVNYKAIAGGSPFNVAVGLRRLGIESALFSGLSTDYL
GRRLQQVLLNEGVSTRYLLDFDAPTTLAMVAVGANGSPHYSFRGEGCADRQLSLDHLPEL
GPEVRGLHVGSFSLVVQPVADTLLALVQRESGRRLISLDPNVRLNPQPDIELWRSRIATL
VQYADLIKVSDEDLGLLYPGIEPQAVIEGWLKHRCQVVFLTRGGQGATVFSRQHGTWSLP
ACPVKIADTVGAGDTFQAALIAWLTEQQLDSIEGLQTLTREQVSAMLEFAIRAAALTCGK
TGPDLPYRQQLA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory