SitesBLAST
Comparing AO356_28340 FitnessBrowser__pseudo5_N2C3_1:AO356_28340 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 19 hits to proteins with known functional sites (download)
P46349 Gamma-aminobutyric acid permease; GABA permease; 4-aminobutyrate permease; Gamma-aminobutyrate permease; Proline transporter GabP from Bacillus subtilis (strain 168) (see paper)
47% identity, 98% coverage: 7:464/466 of query aligns to 2:457/469 of P46349
- G33 (= G38) mutation to D: Lack of activity.
- G42 (= G47) mutation to S: Lack of activity.
- G301 (≠ S308) mutation to V: Lack of activity.
- G338 (≠ S345) mutation to E: Lack of activity.
- F341 (≠ L348) mutation to S: Lack of activity.
- G414 (≠ A420) mutation to R: Lack of activity.
P15993 Aromatic amino acid transport protein AroP; Aromatic amino acid:H(+) symporter AroP; General aromatic amino acid permease; General aromatic transport system from Escherichia coli (strain K12) (see paper)
37% identity, 91% coverage: 7:429/466 of query aligns to 5:424/457 of P15993
- Y103 (≠ W105) Key residue for tryptophan transport; mutation to F: Decreases tryptophan transport to less than 50% of wild-type levels and reduces the ability of tryptophan to inhibit phenylalanine transport from 95 to 62%.
P24207 Phenylalanine-specific permease; Phenylalanine:H(+) symporter PheP from Escherichia coli (strain K12) (see 3 papers)
37% identity, 90% coverage: 13:432/466 of query aligns to 19:435/458 of P24207
- R26 (= R20) mutation R->G,S,Q: Strong decrease in phenylalanine transport activity.
- P54 (= P48) mutation to A: 50% of wild-type phenylalanine transport activity.; mutation to G: No change in phenylalanine transport activity.; mutation to L: 26% of wild-type phenylalanine transport activity.
- F87 (= F81) mutation to L: No effect on phenylalanine transport activity.
- F90 (≠ Y84) mutation to L: 65% of wild-type phenylalanine transport activity.
- Y92 (≠ D86) mutation to L: 41% of wild-type phenylalanine transport activity.
- Y94 (≠ A88) mutation to L: 69% of wild-type phenylalanine transport activity.
- W95 (≠ I89) mutation to L: 10% of wild-type phenylalanine transport activity.
- F98 (≠ W92) mutation to L: No effect on phenylalanine transport activity.
- F101 (= F95) mutation to L: 38% of wild-type phenylalanine transport activity.
- W105 (= W99) mutation to L: 39% of wild-type phenylalanine transport activity.
- Y107 (= Y101) mutation to L: No effect on phenylalanine transport activity.
- W108 (= W102) mutation to L: 71% of wild-type phenylalanine transport activity.
- F111 (≠ W105) mutation to L: 60% of wild-type phenylalanine transport activity.; mutation to Y: Enables the transport of tryptophan to almost the same steady-state level as that of phenylalanine.
- E118 (= E112) mutation E->G,L,V,N: Loss of activity.
- K168 (= K162) mutation K->L,R: Strong decrease in phenylalanine transport activity.; mutation to N: Loss of activity.
- E226 (= E222) mutation E->A,Q,K,R,W: Loss of activity.
- R252 (= R248) mutation R->D,E,F,W,P: Loss of activity.
- P341 (= P338) mutation to A: 5% of wild-type phenylalanine transport activity.; mutation P->G,Q,K,R: Loss of activity.; mutation to S: 3% of wild-type phenylalanine transport activity.; mutation to T: 17% of wild-type phenylalanine transport activity.
Sites not aligning to the query:
- 442 P→A: 46% of wild-type phenylalanine transport activity.; P→G: 52% of wild-type phenylalanine transport activity.; P→L: 43% of wild-type phenylalanine transport activity.
P25737 Lysine-specific permease LysP; Lysine transporter LysP; Trigger transporter LysP from Escherichia coli (strain K12) (see 2 papers)
37% identity, 88% coverage: 1:408/466 of query aligns to 1:418/489 of P25737
- M1 (= M1) modified: Initiator methionine, Removed
- Y102 (= Y101) mutation to L: Retains 4% of wild-type lysine uptake activity. Increases the capacity to inhibit CadC in the presence of lysine.
- W106 (= W105) mutation to L: Retains 20% of wild-type lysine uptake activity. Increases the capacity to inhibit CadC in the presence of lysine.
- K163 (= K162) mutation to A: Retains 24% of wild-type lysine uptake activity. Increases the capacity to inhibit CadC in the presence of lysine.
- F216 (= F216) mutation to L: Retains 13% of wild-type lysine uptake activity. Increases the capacity to inhibit CadC in the presence of lysine.
- E222 (= E222) mutation to A: Abolishes lysine uptake. Strongly inhibits CadC.
- E230 (= E230) mutation to V: Abolishes lysine uptake. Shows significant less inhibition of CadC.
- D275 (vs. gap) Essential for the stimulus-dependent interaction with CadC; mutation to A: Retains 88% of wild-type lysine uptake activity, but can hardly inhibit CadC. Cannot interact with CadC; when associated with A-278.
- D278 (vs. gap) Essential for the stimulus-dependent interaction with CadC; mutation to A: Retains 88% of wild-type lysine uptake activity, but can hardly inhibit CadC. Cannot interact with CadC; when associated with A-275.
Sites not aligning to the query:
- 438 E→A: Retains 14% of wild-type lysine uptake activity. Is unable to inhibit CadC.
- 443 D→A: Retains 11% of wild-type lysine uptake activity. Is unable to inhibit CadC.
- 446 D→A: Retains 13% of wild-type lysine uptake activity. Is unable to inhibit CadC.
P04817 Arginine permease CAN1; Canavanine resistance protein 1 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
32% identity, 90% coverage: 9:428/466 of query aligns to 80:516/590 of P04817
- P113 (≠ A42) mutation to L: In CAN1-343; confers citrulline transport activity in GAP1-deleted cells.
- P148 (= P76) mutation to L: In CAN1-337; confers citrulline transport activity in GAP1-deleted cells and leads to sensitivity to L-glutamic acid alpha-hydroxamate, alpha-aminoisobutyrate, 3-chloro-L-alanine, L-ethionine, L-allylglycine, and D-histidine, but not sensitivity to L-aspartic acid alpha-hydroxamate or p-fluoro-L-phenylalanine.
- V149 (≠ D77) mutation to F: In CAN1-315; confers citrulline transport activity in GAP1-deleted cells.
- S152 (= S80) mutation to F: In CAN1-342; confers citrulline transport activity in GAP1-deleted cells.
- Y173 (= Y101) mutation to D: In CAN1-306; confers citrulline transport activity in GAP1-deleted cells.; mutation to H: In CAN1-327; confers citrulline transport activity in GAP1-deleted cells.
- G308 (≠ A229) mutation to A: In CAN1-341; confers citrulline transport activity in GAP1-deleted cells.
- P313 (= P234) mutation to S: In CAN1-329; confers citrulline transport activity in GAP1-deleted cells and leads to sensitivity to L-glutamic acid alpha-hydroxamate, alpha-aminoisobutyrate, 3-chloro-L-alanine, L-ethionine, L-allylglycine, and D-histidine, L-aspartic acid alpha-hydroxamate and p-fluoro-L-phenylalanine.
- TS 354:355 (≠ GS 275:276) mutation Missing: In CAN1-318; confers citrulline transport activity in GAP1-deleted cells.
- Y356 (= Y277) mutation to H: In CAN1-340; confers citrulline transport activity in GAP1-deleted cells.; mutation to N: In CAN1-339; confers citrulline transport activity in GAP1-deleted cells.
- W451 (≠ F366) mutation to C: In CAN1-328; confers citrulline transport activity in GAP1-deleted cells.; mutation to L: In CAN1-316; confers citrulline transport activity in GAP1-deleted cells.; mutation to S: In CAN1-335; confers citrulline transport activity in GAP1-deleted cells.
- F461 (≠ L376) mutation to S: In CAN1-307; confers citrulline transport activity in GAP1-deleted cells.
Q9URZ4 Cationic amino acid transporter 1 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
32% identity, 86% coverage: 13:412/466 of query aligns to 80:488/587 of Q9URZ4
Sites not aligning to the query:
- 29 modified: Phosphoserine
- 30 modified: Phosphoserine
- 37 modified: Phosphoserine
P48813 High-affinity glutamine permease from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
30% identity, 85% coverage: 7:400/466 of query aligns to 139:544/663 of P48813
Sites not aligning to the query:
- 132 modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
P19145 General amino-acid permease GAP1 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 3 papers)
31% identity, 88% coverage: 13:424/466 of query aligns to 86:516/602 of P19145
- A297 (≠ I219) mutation to V: Impairs basic amino-acids transport and regulation by these amino-acids.
Sites not aligning to the query:
- 76 modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
Q03770 SPS-sensor component SSY1; Amino-acid permease homolog SSY1 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
23% identity, 86% coverage: 12:410/466 of query aligns to 276:755/852 of Q03770
- T382 (≠ G117) mutation T->H,L: Constitutively active, up-regulates amino acid permease transcription in response to subthreshold concentrations of amino acids.; mutation to K: In SSY1-102; constitutively active, up-regulates amino acid permease transcription in the absence of amino-acids.; mutation to R: Constitutively active, up-regulates amino acid permease transcription in the absence of amino acids.
6f34A Crystal structure of a bacterial cationic amino acid transporter (cat) homologue bound to arginine. (see paper)
24% identity, 85% coverage: 21:417/466 of query aligns to 31:420/458 of 6f34A
- binding arginine: I40 (= I30), G42 (= G32), T43 (≠ A33), G44 (= G34), E115 (≠ V108), Y116 (≠ I109), A119 (vs. gap), F228 (= F216), A229 (≠ S217), I231 (= I219), V314 (≠ C304)
- binding cholesterol: W201 (vs. gap), Y202 (≠ F174)
- binding : D31 (≠ H21), M34 (= M24), A178 (≠ G152), R179 (≠ E153), A186 (≠ M160), I187 (≠ A161), A190 (≠ V164), L194 (≠ G168), Q296 (≠ A289), V299 (≠ L292)
Sites not aligning to the query:
P76037 Putrescine importer PuuP from Escherichia coli (strain K12) (see paper)
26% identity, 68% coverage: 12:327/466 of query aligns to 17:327/461 of P76037
- Y110 (≠ W105) mutation to X: The uptake activity is reduced to one-eighth of that of wild-type.
5oqtA Crystal structure of a bacterial cationic amino acid transporter (cat) homologue (see paper)
23% identity, 85% coverage: 21:417/466 of query aligns to 29:418/456 of 5oqtA
- binding alanine: I38 (= I30), G40 (= G32), T41 (≠ A33), G42 (= G34), F226 (= F216), A227 (≠ S217), I229 (= I219)
- binding : D29 (≠ H21), M32 (= M24), A176 (≠ G152), R177 (≠ E153), A184 (≠ M160), A188 (≠ V164), L192 (≠ G168), Q294 (≠ A289), V297 (≠ L292)
Sites not aligning to the query:
3l1lA Structure of arg-bound escherichia coli adic (see paper)
24% identity, 75% coverage: 22:371/466 of query aligns to 9:338/423 of 3l1lA
O34739 Serine/threonine exchanger SteT from Bacillus subtilis (strain 168) (see paper)
20% identity, 92% coverage: 25:454/466 of query aligns to 20:436/438 of O34739
- C94 (≠ I97) mutation to S: Retains 25% of the transport activity; when associated with S-141; S-168; S-291 and S-415.
- C141 (≠ A141) mutation to S: Retains 25% of the transport activity; when associated with S-94; S-168; S-291 and S-415.
- C168 (≠ G168) mutation to S: Retains 25% of the transport activity; when associated with S-94; S-141; S-291 and S-415.
- C291 (= C304) mutation to S: Retains 25% of the transport activity; when associated with S-94; S-141; S-168 and S-415.
- C415 (≠ S433) mutation to S: Retains 25% of the transport activity; when associated with S-94; S-141; S-168 and S-291.
P60061 Arginine/agmatine antiporter from Escherichia coli (strain K12) (see 3 papers)
24% identity, 78% coverage: 7:371/466 of query aligns to 3:355/445 of P60061
- I23 (= I30) binding ; binding
- S26 (≠ A33) binding
- Y93 (= Y101) mutation to L: Greatly decreased Arg uptake into liposomes.
- A96 (vs. gap) binding ; binding
- C97 (≠ F104) binding
- N101 (≠ V108) binding ; mutation to A: Vmax for Arg-Agm exchange 1% of wild-type, KM increases 3-fold.; mutation to D: Nearly wild-type Arg-Agm exchange.
- M104 (≠ I111) binding ; mutation to A: 30% decreased affinity for Arg, 50% decreased affinity for Agm.
- W202 (≠ F216) binding ; mutation to L: Halves Arg uptake into liposomes.
- S203 (= S217) binding
- I205 (= I219) binding ; binding ; mutation to A: About wild-type affinity for Arg and Agm.
- W293 (vs. gap) binding ; mutation W->C,H,L: Loss of Arg-Agm exchange.; mutation W->F,Y: Less than 20% Arg-Agm exchange activity. Vmax 15% of wild-type rate.
Sites not aligning to the query:
- 357 binding ; S→A: 20% decreased affinity for Arg, 40% decrease affinity for Agm.
P60063 Arginine/agmatine antiporter from Escherichia coli O157:H7 (see 3 papers)
24% identity, 78% coverage: 7:371/466 of query aligns to 3:355/445 of P60063
- N22 (≠ G29) mutation to A: No change in antiport activity, 6-fold higher affinity for Arg.
- I23 (= I30) binding
- GSG 25:27 (≠ GAG 32:34) Helix-breaking GSG motif TM1
- S26 (≠ A33) binding ; mutation to K: 5% Agm antiport.
- G27 (= G34) binding
- Y74 (≠ S82) mutation to A: 50% antiport activity at pH 6.0, 10-fold higher than wild-type antiport activity at pH 7.5, i.e. loss of pH-dependence of substrate transport. No change in binding of Arg or Agm.; mutation Y->C,H,L,M,Q,S: Loss of pH-dependence of substrate transport.; mutation to F: Approximately wild-type antiport.
- Y87 (≠ F95) mutation to A: Markedly reduced binding affinity for Agm but not for Arg. 50% Agm antiport.
- Y93 (= Y101) mutation to A: Reduced binding affinity for Arg, no binding to Agm. 25% Agm antiport.; mutation to K: Almost no binding to both Arg and Agm. 5% Agm antiport.
- A96 (vs. gap) binding
- C97 (≠ F104) binding
- N101 (≠ V108) binding
- W202 (≠ F216) Periplasmic (proximal) gate; binding
- I205 (= I219) binding
- GVESA 206:210 (≠ GTEAV 220:224) Helix-breaking GVESA motif TM6
- E208 (= E222) mutation E->A,D: 5-10% Agm antiport.
- W293 (vs. gap) binding
- F337 (= F355) mutation to A: Severely decreased antiport.
Sites not aligning to the query:
- 357 binding
- 365 Y→A: Markedly weakened binding to Arg but not to Agm. 5% Agm antiport.
5j4nA Crystal structure of the l-arginine/agmatine antiporter adic in complex with agmatine at 2.6 angstroem resolution (see paper)
24% identity, 75% coverage: 22:371/466 of query aligns to 11:351/437 of 5j4nA
P30825 High affinity cationic amino acid transporter 1; CAT-1; CAT1; Ecotropic retroviral leukemia receptor homolog; Ecotropic retrovirus receptor homolog; Solute carrier family 7 member 1; System Y+ basic amino acid transporter from Homo sapiens (Human) (see paper)
21% identity, 83% coverage: 12:398/466 of query aligns to 27:439/629 of P30825
- N226 (≠ S187) modified: carbohydrate, N-linked (GlcNAc...) asparagine
Q22397 Amino acid transporter protein 6 from Caenorhabditis elegans (see paper)
24% identity, 61% coverage: 137:419/466 of query aligns to 151:423/523 of Q22397
Sites not aligning to the query:
- 521:523 PDZ-binding motif; mutation Missing: Abolishes the interaction with nrfl-1.
Query Sequence
>AO356_28340 FitnessBrowser__pseudo5_N2C3_1:AO356_28340
MTSPSFKDSNGHLAQGFKPRHVTMLSIAGIIGAGLFVGSGHAIAAAGPAVMLAYLFSGLL
VVLVMRMLGEMAVANPDTGSFSTYADQAIGRWAGFTIGWLYWWFWVLVIPIEALAAGHVL
NQWFPAVDAWLFASVSIVLLAVTNLFSVSKYGEFEFWFAMAKVVAIIGFISLGFAVLMGW
IPEREASGLSRLMEEHGGFAPNGLSAVVGAFITIMFSFIGTEAVTIAAAESDNPAQNIAK
ATRSVIWRIGVFYLLSIFVVISVVPWNDPLLASVGSYQRALELMNIPHAKFLVDMVVLIA
VASCMNSSIYIASRMLYSLGRRGDAPKALKVTSSAGVPRSAVIASTVLGAGVTLFSYFMP
AGLFQFLLASSGAIALLVYLVIAISQLRMRRMMQRQNIELPFRMWLFPWLTWLVIVFISA
ALAVMMITPEHRSEVSTTLGLALIISFIGLATSRHAPQPERVASLG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory