Comparing AO356_28370 FitnessBrowser__pseudo5_N2C3_1:AO356_28370 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1ji0A Crystal structure analysis of the abc transporter from thermotoga maritima
47% identity, 91% coverage: 7:247/265 of query aligns to 6:238/240 of 1ji0A
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
31% identity, 86% coverage: 7:234/265 of query aligns to 4:236/254 of 1g6hA
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
31% identity, 86% coverage: 7:234/265 of query aligns to 4:236/253 of 1g9xB
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
33% identity, 85% coverage: 24:247/265 of query aligns to 18:235/240 of 6mjpA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
28% identity, 82% coverage: 23:239/265 of query aligns to 16:227/240 of 4ymuJ
Sites not aligning to the query:
3c4jA Abc protein artp in complex with atp-gamma-s
27% identity, 87% coverage: 8:238/265 of query aligns to 1:228/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
27% identity, 87% coverage: 8:238/265 of query aligns to 1:228/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
27% identity, 87% coverage: 8:238/265 of query aligns to 1:228/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
27% identity, 87% coverage: 8:238/265 of query aligns to 1:228/242 of 2oljA
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
28% identity, 88% coverage: 6:239/265 of query aligns to 1:227/241 of 4u00A
6z4wA Ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) (see paper)
30% identity, 85% coverage: 7:231/265 of query aligns to 3:222/230 of 6z4wA
6z67B Ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution (see paper)
30% identity, 85% coverage: 7:231/265 of query aligns to 3:222/229 of 6z67B
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
30% identity, 85% coverage: 24:247/265 of query aligns to 18:235/235 of 6mhzA
Sites not aligning to the query:
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
30% identity, 85% coverage: 24:247/265 of query aligns to 18:235/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
30% identity, 85% coverage: 24:247/265 of query aligns to 18:235/238 of 6s8gA
Sites not aligning to the query:
3d31A Modbc from methanosarcina acetivorans (see paper)
30% identity, 81% coverage: 22:235/265 of query aligns to 14:215/348 of 3d31A
Sites not aligning to the query:
6mbnA Lptb e163q in complex with atp (see paper)
30% identity, 85% coverage: 24:247/265 of query aligns to 19:236/241 of 6mbnA
Sites not aligning to the query:
6b89A E. Coli lptb in complex with adp and novobiocin (see paper)
30% identity, 84% coverage: 24:246/265 of query aligns to 18:234/234 of 6b89A
Sites not aligning to the query:
4p31A Crystal structure of a selenomethionine derivative of e. Coli lptb in complex with adp-magensium (see paper)
30% identity, 84% coverage: 24:246/265 of query aligns to 18:234/234 of 4p31A
Sites not aligning to the query:
P55339 ABC-type transporter ATP-binding protein EcsA from Bacillus subtilis (strain 168) (see paper)
27% identity, 83% coverage: 24:243/265 of query aligns to 19:229/247 of P55339
>AO356_28370 FitnessBrowser__pseudo5_N2C3_1:AO356_28370
MATNVPILQIDDIEVLYEQTILAVRSVSLEVEKGQVVVLLGANGAGKSTTLKAASNLVRA
ERGEVVRGRIVYQGKDVTRSAPHTLAASGLVQVLEGRHCFAQLTVEENLLAGALARQVPR
RQLLADLELVYGHFPRLKLRRKSLAGYTSGGEQQMIAIGRALMARPQLVLLDEPSMGLAP
QIVEEIFEIVRQLNQRDGVSFLIAEQNINVALRYAHHGYVLESGRVVSEGSAEQLAARSD
LQDFYLGARAGARAEEPLGVGARSG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory