SitesBLAST
Comparing AO356_28390 FitnessBrowser__pseudo5_N2C3_1:AO356_28390 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
32% identity, 96% coverage: 9:257/260 of query aligns to 4:253/253 of 1g9xB
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
32% identity, 96% coverage: 9:257/260 of query aligns to 4:253/254 of 1g6hA
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
30% identity, 96% coverage: 9:257/260 of query aligns to 2:235/240 of 6mjpA
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
30% identity, 95% coverage: 10:257/260 of query aligns to 3:235/235 of 6mhzA
- binding adp orthovanadate: Y12 (≠ F19), N37 (= N44), G38 (= G45), G40 (= G47), K41 (= K48), T42 (≠ S49), T43 (≠ S50), Q84 (= Q91), S136 (≠ T157), S138 (≠ P159), G139 (≠ Y160), G140 (= G161), E162 (= E183), G166 (= G187), H194 (= H216)
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
30% identity, 95% coverage: 10:257/260 of query aligns to 3:235/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
30% identity, 95% coverage: 10:257/260 of query aligns to 3:235/238 of 6s8gA
- binding phosphoaminophosphonic acid-adenylate ester: Y12 (≠ F19), R15 (≠ V22), N37 (= N44), G40 (= G47), K41 (= K48), T42 (≠ S49), T43 (≠ S50), Q84 (= Q91), S136 (≠ T157), S138 (≠ P159), E141 (≠ L162)
6mbnA Lptb e163q in complex with atp (see paper)
30% identity, 95% coverage: 10:257/260 of query aligns to 4:236/241 of 6mbnA
6b89A E. Coli lptb in complex with adp and novobiocin (see paper)
30% identity, 95% coverage: 10:256/260 of query aligns to 3:234/234 of 6b89A
- binding adenosine-5'-diphosphate: Y12 (≠ F19), R15 (≠ V22), V17 (≠ A24), N37 (= N44), G38 (= G45), G40 (= G47), K41 (= K48), T42 (≠ S49), T43 (≠ S50)
- binding magnesium ion: T42 (≠ S49), Q84 (= Q91)
- binding novobiocin: L71 (≠ P78), H72 (= H79), P83 (≠ F90), A86 (≠ I93), S87 (≠ A94), F89 (= F96), R90 (≠ K97), R91 (≠ G98), L92 (≠ M99), V101 (≠ G108), Q135 (≠ G156), R149 (= R170)
4p31A Crystal structure of a selenomethionine derivative of e. Coli lptb in complex with adp-magensium (see paper)
30% identity, 95% coverage: 10:256/260 of query aligns to 3:234/234 of 4p31A
6b8bA E. Coli lptb in complex with adp and a novobiocin derivative (see paper)
30% identity, 95% coverage: 10:255/260 of query aligns to 3:233/233 of 6b8bA
- binding adenosine-5'-diphosphate: Y12 (≠ F19), R15 (≠ V22), V17 (≠ A24), G38 (= G45), G40 (= G47), K41 (= K48), T42 (≠ S49), T43 (≠ S50)
- binding (3s,5s,7s)-N-{7-[(3-O-carbamoyl-6-deoxy-5-methyl-4-O-methyl-beta-D-gulopyranosyl)oxy]-4-hydroxy-8-methyl-2-oxo-2H-1-benzopyran-3-yl}tricyclo[3.3.1.1~3,7~]decane-1-carboxamide: F89 (= F96), R90 (≠ K97), R91 (≠ G98)
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
28% identity, 98% coverage: 4:257/260 of query aligns to 12:249/378 of P69874
- C26 (≠ S18) mutation to A: Lower ATPase activity and transport efficiency.
- F27 (= F19) mutation to L: Lower ATPase activity and transport efficiency.
- F45 (≠ I37) mutation to L: Lower ATPase activity and transport efficiency.
- C54 (≠ A46) mutation to T: Loss of ATPase activity and transport.
- L60 (= L52) mutation to F: Lower ATPase activity and transport efficiency.
- L76 (≠ F68) mutation to P: Lower ATPase activity and transport efficiency.
- V135 (≠ L145) mutation to M: Loss of ATPase activity and transport.
- D172 (= D182) mutation to N: Loss of ATPase activity and transport.
Sites not aligning to the query:
- 276 C→A: Lower ATPase activity and transport efficiency.
- 297 mutation E->K,D: Lower ATPase activity and transport efficiency.; E→Q: Loss of ATPase activity and transport.
P9WQI3 Trehalose import ATP-binding protein SugC; MtbSugC; Nucleotide-binding domain of SugABC transporter; NBD of SugABC transporter; SugABC transporter ATPase SugC; EC 7.5.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
30% identity, 95% coverage: 12:258/260 of query aligns to 6:237/393 of P9WQI3
- H193 (= H216) mutation to A: Decreased hydrolysis of ATP. No change in KM, but 2-fold reduction in Vmax compared to wild-type.
2awnB Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
29% identity, 96% coverage: 10:258/260 of query aligns to 3:235/374 of 2awnB
1q12A Crystal structure of the atp-bound e. Coli malk (see paper)
29% identity, 96% coverage: 10:258/260 of query aligns to 1:233/367 of 1q12A
- binding adenosine-5'-triphosphate: W10 (≠ F19), S35 (≠ N44), G36 (= G45), C37 (≠ A46), G38 (= G47), K39 (= K48), S40 (= S49), T41 (≠ S50), R126 (≠ V153), A130 (≠ T157), S132 (≠ P159), G134 (= G161), Q135 (≠ L162)
P68187 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Escherichia coli (strain K12) (see 5 papers)
29% identity, 96% coverage: 10:258/260 of query aligns to 4:236/371 of P68187
- A85 (= A94) mutation to M: Suppressor of EAA loop mutations in MalFG.
- K106 (≠ R128) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V114 (≠ A138) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V117 (= V141) mutation to M: Suppressor of EAA loop mutations in MalFG.
- E119 (≠ A143) mutation to K: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- A124 (≠ Q148) mutation to T: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- G137 (= G161) mutation to A: Loss of maltose transport. Has greater ability to decrease mal gene expression than wild-type MalK.
- D158 (= D182) mutation to N: Loss of maltose transport but retains ability to repress mal genes.
- R228 (≠ E250) mutation to C: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
Sites not aligning to the query:
- 241 F→I: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 267 W→G: Normal maltose transport but constitutive mal gene expression.
- 278 G→P: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 282 S→L: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 284 G→S: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 302 G→D: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 308 E→Q: Maltose transport is affected but retains ability to interact with MalT.
- 322 S→F: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 340 G→A: Maltose transport is affected but retains ability to interact with MalT.
- 346 G→S: Normal maltose transport but constitutive mal gene expression.
- 355 F→Y: Maltose transport is affected but retains ability to interact with MalT.
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
29% identity, 96% coverage: 10:258/260 of query aligns to 3:235/371 of 3puyA
- binding phosphoaminophosphonic acid-adenylate ester: W12 (≠ F19), S37 (≠ N44), G38 (= G45), C39 (≠ A46), G40 (= G47), K41 (= K48), S42 (= S49), T43 (≠ S50), Q81 (= Q91), R128 (≠ V153), A132 (≠ T157), S134 (≠ P159), G136 (= G161), Q137 (≠ L162), E158 (= E183), H191 (= H216)
- binding magnesium ion: S42 (= S49), Q81 (= Q91)
3puxA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 (see paper)
29% identity, 96% coverage: 10:258/260 of query aligns to 3:235/371 of 3puxA
- binding adenosine-5'-diphosphate: W12 (≠ F19), G38 (= G45), C39 (≠ A46), G40 (= G47), K41 (= K48), S42 (= S49), T43 (≠ S50), R128 (≠ V153), S134 (≠ P159), Q137 (≠ L162)
- binding beryllium trifluoride ion: S37 (≠ N44), G38 (= G45), K41 (= K48), Q81 (= Q91), S134 (≠ P159), G136 (= G161), H191 (= H216)
- binding magnesium ion: S42 (= S49), Q81 (= Q91)
3puwA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4 (see paper)
29% identity, 96% coverage: 10:258/260 of query aligns to 3:235/371 of 3puwA
- binding adenosine-5'-diphosphate: W12 (≠ F19), V17 (≠ A24), G38 (= G45), C39 (≠ A46), G40 (= G47), K41 (= K48), S42 (= S49), T43 (≠ S50), R128 (≠ V153), A132 (≠ T157), S134 (≠ P159), Q137 (≠ L162)
- binding tetrafluoroaluminate ion: S37 (≠ N44), G38 (= G45), K41 (= K48), Q81 (= Q91), S134 (≠ P159), G135 (≠ Y160), G136 (= G161), E158 (= E183), H191 (= H216)
- binding magnesium ion: S42 (= S49), Q81 (= Q91)
3puvA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4 (see paper)
29% identity, 96% coverage: 10:258/260 of query aligns to 3:235/371 of 3puvA
- binding adenosine-5'-diphosphate: W12 (≠ F19), V17 (≠ A24), G38 (= G45), C39 (≠ A46), G40 (= G47), K41 (= K48), S42 (= S49), T43 (≠ S50), R128 (≠ V153), A132 (≠ T157), S134 (≠ P159), Q137 (≠ L162)
- binding magnesium ion: S42 (= S49), Q81 (= Q91)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
29% identity, 89% coverage: 9:239/260 of query aligns to 4:222/501 of P04983
- K43 (= K48) mutation to R: Loss of transport.
Query Sequence
>AO356_28390 FitnessBrowser__pseudo5_N2C3_1:AO356_28390
MTQTAITHLLELEHISLSFKGVKAVTDISFRVVAGEICALIGPNGAGKSSLLNVISGVYQ
AQDGHIRFDRQERRRMRPHDVAVRGIARTFQNIALFKGMSVLDNVLTGRNLKRRSTWIEQ
ALRIGRARAEDDRQREAAERVIAFLHLQPWRDVLVGTLPYGLQKRVELARALAAEPRLLL
LDEPMAGMNADEKQQMSRFIVDINRELGTTVVLIEHDIGVVMDISDHVVVLDYGRKIGDG
SPEDVRQNPEVISAYLGTRH
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory