SitesBLAST
Comparing AO356_28460 FitnessBrowser__pseudo5_N2C3_1:AO356_28460 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4bmsF Short chain alcohol dehydrogenase from ralstonia sp. Dsm 6428 in complex with NADPH
42% identity, 98% coverage: 1:245/250 of query aligns to 1:245/249 of 4bmsF
- active site: S137 (= S137), H147 (≠ S147), Y150 (= Y150), K154 (= K154), Q195 (≠ D195)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G13), N15 (≠ T15), S16 (= S16), I18 (= I18), R38 (≠ V38), R39 (≠ N39), A59 (= A59), D60 (= D60), V61 (≠ S61), N87 (= N87), S88 (≠ A88), G89 (= G89), V110 (≠ I110), S137 (= S137), Y150 (= Y150), K154 (= K154), G181 (= G181), I183 (≠ V183), T185 (= T185), I187 (≠ L187)
6ihhA Crystal structure of rasadh f12 from ralstonia.Sp in complex with NADPH and a6o
42% identity, 98% coverage: 1:245/250 of query aligns to 1:245/249 of 6ihhA
- binding (2R,3S)-2-ethyl-2-[(2E)-2-(6-methoxy-3,4-dihydro-2H-naphthalen-1-ylidene)ethyl]-3-oxidanyl-cyclopentan-1-one: S137 (= S137), H147 (≠ S147), Y150 (= Y150), L188 (≠ Y188)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G13), N15 (≠ T15), S16 (= S16), G17 (= G17), I18 (= I18), R38 (≠ V38), R39 (≠ N39), D60 (= D60), V61 (≠ S61), N87 (= N87), S88 (≠ A88), G89 (= G89), V110 (≠ I110), T135 (= T135), S137 (= S137), Y150 (= Y150), K154 (= K154), P180 (= P180), G181 (= G181), A182 (≠ P182), I183 (≠ V183), T185 (= T185), S187 (≠ L187)
Sites not aligning to the query:
4esoB Crystal structure of a putative oxidoreductase protein from sinorhizobium meliloti 1021 in complex with NADP
41% identity, 96% coverage: 5:245/250 of query aligns to 4:243/251 of 4esoB
- active site: G16 (= G17), S136 (= S137), M146 (≠ S147), Y149 (= Y150), K153 (= K154)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G13), T14 (= T15), H15 (≠ S16), M17 (≠ I18), R37 (≠ V38), N38 (= N39), N41 (≠ S42), S58 (≠ A59), D59 (= D60), I60 (≠ S61), N86 (= N87), A87 (= A88), G88 (= G89), T134 (= T135), S136 (= S137), Y149 (= Y150), P179 (= P180), G180 (= G181), I182 (≠ V183), T184 (= T185), T186 (≠ L187), K187 (≠ Y188), G188 (≠ D189)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
35% identity, 99% coverage: 1:248/250 of query aligns to 2:244/244 of 4nbuB
- active site: G18 (= G17), N111 (= N111), S139 (= S137), Q149 (≠ S147), Y152 (= Y150), K156 (= K154)
- binding acetoacetyl-coenzyme a: D93 (≠ W93), K98 (≠ E98), S139 (= S137), N146 (≠ A144), V147 (≠ D145), Q149 (≠ S147), Y152 (= Y150), F184 (≠ P182), M189 (≠ L187), K200 (≠ A204)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G13), N17 (≠ S16), G18 (= G17), I19 (= I18), D38 (≠ G37), F39 (≠ V38), V59 (≠ A59), D60 (= D60), V61 (≠ S61), N87 (= N87), A88 (= A88), G89 (= G89), I90 (≠ V90), T137 (= T135), S139 (= S137), Y152 (= Y150), K156 (= K154), P182 (= P180), F184 (≠ P182), T185 (≠ V183), T187 (= T185), M189 (≠ L187)
5t2uA Short chain dehydrogenase/reductase family protein (see paper)
37% identity, 97% coverage: 4:245/250 of query aligns to 4:237/241 of 5t2uA
- active site: G17 (= G17), T135 (≠ S137), T145 (≠ S147), Y148 (= Y150), K152 (= K154)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G13), G17 (= G17), R38 (≠ V38), D39 (≠ N39), R42 (≠ S42), D60 (= D60), L61 (≠ S61), N83 (= N87), A84 (= A88), Y87 (≠ W93), I133 (≠ T135), T135 (≠ S137), Y148 (= Y150), K152 (= K154), P178 (= P180), P180 (= P182), T181 (≠ V183), T183 (= T185), T185 (≠ A196), T186 (≠ Y197)
4wecA Crystal structure of a short chain dehydrogenase from mycobacterium smegmatis
39% identity, 97% coverage: 3:245/250 of query aligns to 7:249/258 of 4wecA
- active site: G21 (= G17), S143 (= S137), Q154 (≠ S148), Y157 (= Y150), K161 (= K154)
- binding nicotinamide-adenine-dinucleotide: G17 (= G13), A19 (≠ T15), S20 (= S16), G21 (= G17), I22 (= I18), D41 (≠ G37), I42 (≠ V38), V61 (= V56), D62 (= D60), V63 (≠ S61), N89 (= N87), T141 (= T135), Y157 (= Y150), K161 (= K154), P187 (= P180), P189 (= P182), V190 (= V183)
7v0hG Crystal structure of putative glucose 1-dehydrogenase from burkholderia cenocepacia in complex with NADP and a potential reaction product
35% identity, 98% coverage: 1:245/250 of query aligns to 6:251/253 of 7v0hG
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G13), S20 (≠ T15), K21 (≠ S16), G22 (= G17), I23 (= I18), A43 (vs. gap), S44 (vs. gap), S45 (≠ T36), G68 (≠ A59), D69 (= D60), V70 (≠ S61), N96 (= N87), S97 (≠ A88), G98 (= G89), Y100 (≠ S91), I144 (≠ T135), S146 (= S137), Y159 (= Y150), K163 (= K154), P189 (= P180), G190 (= G181), M191 (≠ P182), I192 (≠ V183), T194 (= T185), G196 (≠ L187), T197 (≠ Y188)
- binding (2R)-2-(hydroxymethyl)pentanedioic acid: S146 (= S137), Y159 (= Y150), M191 (≠ P182), I202 (= I193)
7ejhA Crystal structure of kred mutant-f147l/l153q/y190p/l199a/m205f/m206f and 2-hydroxyisoindoline-1,3-dione complex
33% identity, 97% coverage: 3:245/250 of query aligns to 5:249/253 of 7ejhA
- binding 2-oxidanylisoindole-1,3-dione: S144 (= S137), I145 (≠ V138), E146 (≠ S139), Y157 (= Y150), V197 (≠ Y188), F207 (≠ R198)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G13), T17 (= T15), I20 (= I18), R40 (≠ V38), H41 (≠ N39), D64 (= D60), A65 (≠ S61), N91 (= N87), A92 (= A88), V114 (≠ I110), M142 (≠ T135), S144 (= S137), Y157 (= Y150), K161 (= K154), P189 (= P180), G190 (= G181), P191 (= P182), I192 (≠ V183), T194 (= T185), P195 (= P186), L196 (= L187)
7ejiB Crystal structure of kred f147l/l153q/y190p/l199a/m205f/m206f variant and methyl methacrylate complex
33% identity, 97% coverage: 3:245/250 of query aligns to 3:247/251 of 7ejiB
- binding methyl 2-methylprop-2-enoate: S142 (= S137), I143 (≠ V138), Y155 (= Y150), F205 (≠ R198)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G13), T15 (= T15), L16 (≠ S16), G17 (= G17), I18 (= I18), R38 (≠ V38), H39 (≠ N39), D62 (= D60), A63 (≠ S61), N89 (= N87), A90 (= A88), V112 (≠ I110), M140 (≠ T135), S142 (= S137), Y155 (= Y150), K159 (= K154), P187 (= P180), P189 (= P182), I190 (≠ V183), T192 (= T185), P193 (= P186), L194 (= L187)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
33% identity, 98% coverage: 4:248/250 of query aligns to 3:247/247 of 4jroC
- active site: G16 (= G17), S142 (= S137), Q152 (≠ S147), Y155 (= Y150), K159 (= K154)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G13), S14 (≠ T15), R15 (≠ S16), G16 (= G17), I17 (= I18), N35 (≠ T36), Y36 (vs. gap), N37 (≠ G37), G38 (≠ V38), S39 (≠ N39), N63 (≠ D60), V64 (≠ S61), N90 (= N87), A91 (= A88), I93 (≠ V90), I113 (= I110), S142 (= S137), Y155 (= Y150), K159 (= K154), P185 (= P180), I188 (≠ V183), T190 (= T185)
Q6WVP7 NADP-dependent (R)-specific alcohol dehydrogenase; (R)-specific ADH; Ketoreductase; KRED; EC 1.1.1.- from Lentilactobacillus kefiri (Lactobacillus kefiri) (see paper)
32% identity, 97% coverage: 3:245/250 of query aligns to 4:248/252 of Q6WVP7
Sites not aligning to the query:
1zk4A Structure of r-specific alcohol dehydrogenase (wildtype) from lactobacillus brevis in complex with acetophenone and NADP (see paper)
33% identity, 98% coverage: 2:245/250 of query aligns to 2:247/251 of 1zk4A
- active site: G17 (= G17), S142 (= S137), Y155 (= Y150), K159 (= K154)
- binding 1-phenylethanone: A93 (≠ S91), Y155 (= Y150), Y189 (≠ P182)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G13), T15 (= T15), L16 (≠ S16), I18 (= I18), T36 (= T36), G37 (= G37), R38 (≠ V38), H61 (≠ A59), D62 (= D60), N89 (= N87), A90 (= A88), G91 (= G89), I92 (≠ V90), Y155 (= Y150), G188 (= G181), I190 (≠ V183), T192 (= T185), L194 (= L187)
D4A1J4 Dehydrogenase/reductase SDR family member 6; (R)-beta-hydroxybutyrate dehydrogenase; 3-hydroxybutyrate dehydrogenase type 2; 4-oxo-L-proline reductase; Oxidoreductase UCPA; Short chain dehydrogenase/reductase family 15C member 1; EC 1.1.1.-; EC 1.1.1.30; EC 1.1.1.104 from Rattus norvegicus (Rat) (see paper)
33% identity, 98% coverage: 1:245/250 of query aligns to 1:242/245 of D4A1J4
- Y147 (= Y150) mutation to F: Loss of function.
6y0sAAA R-specific alcohol dehydrogenase (see paper)
33% identity, 98% coverage: 2:245/250 of query aligns to 2:247/251 of 6y0sAAA
7krmC Putative fabg bound to nadh from acinetobacter baumannii
35% identity, 98% coverage: 4:249/250 of query aligns to 3:244/244 of 7krmC
- active site: G18 (= G17), S140 (= S137), Y155 (= Y150)
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), S15 (= S16), G18 (= G17), I19 (= I18), D38 (≠ G37), L39 (≠ V38), A60 (= A59), N61 (≠ D60), V62 (≠ S61), N88 (= N87), V111 (≠ I110), S140 (= S137), Y155 (= Y150), K159 (= K154), I188 (≠ V183), T190 (= T185)
1zk1A Structure of r-specific alcohol dehydrogenase (mutant g37d) from lactobacillus brevis in complex with phenylethanol and NAD (see paper)
33% identity, 98% coverage: 2:245/250 of query aligns to 2:247/251 of 1zk1A
- active site: G17 (= G17), S142 (= S137), Y155 (= Y150), K159 (= K154)
- binding 1-phenylethanone: A93 (≠ S91), N95 (≠ W93), Y155 (= Y150), Y189 (≠ P182)
- binding nicotinamide-adenine-dinucleotide: G13 (= G13), L16 (≠ S16), I18 (= I18), D37 (≠ G37), H61 (≠ A59), D62 (= D60), S63 (= S61), N89 (= N87), A90 (= A88), I92 (≠ V90), M140 (≠ T135), Y155 (= Y150), G188 (= G181), I190 (≠ V183), L194 (= L187)
1zjzA Structure of r-specific alcohol dehydrogenase (mutant g37d) from lactobacillus brevis in complex with phenylethanol and NAD (see paper)
33% identity, 98% coverage: 2:245/250 of query aligns to 2:247/251 of 1zjzA
- active site: G17 (= G17), S142 (= S137), Y155 (= Y150), K159 (= K154)
- binding nicotinamide-adenine-dinucleotide: G13 (= G13), L16 (≠ S16), I18 (= I18), D37 (≠ G37), D62 (= D60), N89 (= N87), A90 (= A88), G91 (= G89), I92 (≠ V90), Y155 (= Y150), G188 (= G181), I190 (≠ V183), L194 (= L187)
- binding (1r)-1-phenylethanol: A93 (≠ S91), N95 (≠ W93), L152 (≠ S147), Y155 (= Y150)
1zjyA Structure of r-specific alcohol dehydrogenase (mutant g37d) from lactobacillus brevis in complex with phenylethanol and nadh (see paper)
33% identity, 98% coverage: 2:245/250 of query aligns to 2:247/251 of 1zjyA
- active site: G17 (= G17), S142 (= S137), Y155 (= Y150), K159 (= K154)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G13 (= G13), L16 (≠ S16), G17 (= G17), I18 (= I18), D37 (≠ G37), D62 (= D60), N89 (= N87), A90 (= A88), G91 (= G89), I92 (≠ V90), Y155 (= Y150), G188 (= G181), I190 (≠ V183), L194 (= L187)
- binding (1r)-1-phenylethanol: A93 (≠ S91), N95 (≠ W93), L152 (≠ S147), Y155 (= Y150), Y189 (≠ P182)
Q8JZV9 Dehydrogenase/reductase SDR family member 6; (R)-beta-hydroxybutyrate dehydrogenase; 3-hydroxybutyrate dehydrogenase type 2; 4-oxo-L-proline reductase; Oxidoreductase UCPA; Short chain dehydrogenase/reductase family 15C member 1; EC 1.1.1.-; EC 1.1.1.30; EC 1.1.1.104 from Mus musculus (Mouse) (see paper)
31% identity, 98% coverage: 1:245/250 of query aligns to 1:242/245 of Q8JZV9
- Y147 (= Y150) active site, Proton acceptor; mutation to F: Loss of function.
6ixmC Crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. Ca49 complexed with NAD (see paper)
31% identity, 97% coverage: 4:245/250 of query aligns to 3:244/248 of 6ixmC
- active site: G16 (= G17), S142 (= S139), Y155 (= Y150), K159 (= K154)
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), S15 (= S16), G16 (= G17), I17 (= I18), D36 (≠ G37), I37 (≠ V38), A61 (= A59), D62 (= D60), T63 (≠ S61), N89 (= N87), A90 (= A88), M140 (≠ S137), S142 (= S139), Y155 (= Y150), K159 (= K154), P185 (= P180), A186 (≠ G181), Y187 (≠ P182), I188 (≠ V183), L192 (= L187)
Query Sequence
>AO356_28460 FitnessBrowser__pseudo5_N2C3_1:AO356_28460
MSRLQGKRTLITGGTSGIGLETAKQFLAEGARVIVTGVNPDSIAKAQAELGPEVPVLRAD
SASVAAQKELAQVIKEHYGQLDVAFLNAGVSVWRPIEEWTEDMFDRIFDINVKGPYFLMQ
ALLPVFANPASVVLTTSVSAHAGADRSSVYAATKAALLNMSKTLSTELLGRGIRVNAVSP
GPVETPLYDKAGIPDAYREQINQAITATIPLGRFGTSDEVAKAVLYLASDESRWTVGSEI
VLDGGRLLNG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory