Comparing AO356_28625 FitnessBrowser__pseudo5_N2C3_1:AO356_28625 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3c4jA Abc protein artp in complex with atp-gamma-s
60% identity, 97% coverage: 10:259/259 of query aligns to 1:242/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
60% identity, 97% coverage: 10:259/259 of query aligns to 1:242/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
60% identity, 97% coverage: 10:259/259 of query aligns to 1:242/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
60% identity, 97% coverage: 10:259/259 of query aligns to 1:242/242 of 2oljA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
58% identity, 95% coverage: 14:259/259 of query aligns to 6:240/240 of 4ymuJ
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
59% identity, 97% coverage: 9:259/259 of query aligns to 2:240/241 of 4u00A
P02915 Histidine/lysine/arginine/ornithine transport ATP-binding protein HisP; EC 7.4.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
55% identity, 95% coverage: 10:256/259 of query aligns to 7:254/258 of P02915
1b0uA Atp-binding subunit of the histidine permease from salmonella typhimurium (see paper)
55% identity, 95% coverage: 10:256/259 of query aligns to 3:250/258 of 1b0uA
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
41% identity, 94% coverage: 16:259/259 of query aligns to 12:245/343 of P30750
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
41% identity, 94% coverage: 16:259/259 of query aligns to 13:246/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
41% identity, 94% coverage: 16:259/259 of query aligns to 13:246/344 of 3tuiC
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
41% identity, 94% coverage: 16:259/259 of query aligns to 13:246/344 of 6cvlD
Sites not aligning to the query:
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
39% identity, 89% coverage: 9:238/259 of query aligns to 4:226/648 of P75831
5lilA Structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) (see paper)
37% identity, 93% coverage: 9:249/259 of query aligns to 3:236/615 of 5lilA
5lj7A Structure of aggregatibacter actinomycetemcomitans macb bound to atp (p21) (see paper)
37% identity, 93% coverage: 9:249/259 of query aligns to 3:236/592 of 5lj7A
2pclA Crystal structure of abc transporter with complex (aq_297) from aquifex aeolicus vf5
39% identity, 87% coverage: 9:234/259 of query aligns to 3:217/223 of 2pclA
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
33% identity, 95% coverage: 10:255/259 of query aligns to 7:243/375 of 2d62A
1g291 Malk (see paper)
36% identity, 95% coverage: 10:255/259 of query aligns to 4:240/372 of 1g291
Sites not aligning to the query:
5ws4A Crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii (see paper)
39% identity, 85% coverage: 22:241/259 of query aligns to 21:231/650 of 5ws4A
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
40% identity, 81% coverage: 21:229/259 of query aligns to 19:217/226 of 5xu1B
>AO356_28625 FitnessBrowser__pseudo5_N2C3_1:AO356_28625
MAHKSEELIIEALDVHKSFGELQILKGISLQVRRGEVVVLIGASGSGKTTFIRCINLLED
IQGGRIRVNGRAMGYRERADGSLVRESERNIARQRRDIGMVFQRFNLFPHMTALENIIEA
PIQVLGVSRVAALEQARGLLERVGLADKADHYPSMLSGGQQQRVAIARALAMKPQAMLFD
EPTSALDPETVGEVLQVMKELAEEGMTMVVVTHEMGFAREVADRVVVLDQGELIEQGPPE
QIFCHPIHPRTRAFLSRVL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory