Comparing AO356_28630 FitnessBrowser__pseudo5_N2C3_1:AO356_28630 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 2 hits to proteins with known functional sites (download)
4ymwC Crystal structure of an amino acid abc transporter with histidines (see paper)
44% identity, 81% coverage: 19:226/258 of query aligns to 15:214/214 of 4ymwC
4ymtC Crystal structure of an amino acid abc transporter complex with arginines (see paper)
42% identity, 84% coverage: 12:227/258 of query aligns to 8:215/215 of 4ymtC
>AO356_28630 FitnessBrowser__pseudo5_N2C3_1:AO356_28630
MNFNWDVFWQYLLQPSGVYLTGLWLTCLISVLAMLLGCALGLAAALLRLSSNPLLHLPVR
FYVWLMRGTPLLVQIVFLYTALAAGGIFRFEDIDLFGLVIPGNIQAAIIALGLNEGAYMA
EIIRAGIGAVDKGQYEAGRSLGMTFAKLMRRIVLPQAFRVIVPPLGNEFNVMLKNTTLVS
VIGVQELLLSTQMVTSATFRVFELYLVVAIYFLLLTTLWGFFQRWLETRFGQSDRPSSPP
PASTRMFGRSTLNLLRAR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory