Comparing AO356_28705 AO356_28705 hypothetical protein to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5lh9D Amine transaminase crystal structure from an uncultivated pseudomonas species in the plp-bound (internal aldimine) form
89% identity, 100% coverage: 2:448/449 of query aligns to 2:448/449 of 5lh9D
5lhaA Amine transaminase crystal structure from an uncultivated pseudomonas species in the pmp-bound form
89% identity, 99% coverage: 3:448/449 of query aligns to 1:446/447 of 5lhaA
6s54A Transaminase from pseudomonas fluorescens (see paper)
51% identity, 96% coverage: 14:445/449 of query aligns to 18:448/453 of 6s54A
6io1B Crystal structure of a novel thermostable (s)-enantioselective omega- transaminase from thermomicrobium roseum (see paper)
44% identity, 97% coverage: 14:448/449 of query aligns to 18:446/448 of 6io1B
6fyqA The crystal structure of a new transaminase from the marine bacterium virgibacillus (see paper)
38% identity, 98% coverage: 9:449/449 of query aligns to 8:439/443 of 6fyqA
6gwiB The crystal structure of halomonas elongata amino-transferase (see paper)
38% identity, 95% coverage: 14:438/449 of query aligns to 16:435/450 of 6gwiB
Q94CE5 Gamma-aminobutyrate transaminase POP2, mitochondrial; AtGABA-T; Gamma-aminobutyric acid aminotransferase 1; Protein HEXENAL RESPONSE 1; Protein POLLEN-PISTIL INCOMPATIBILITY 2; AtPOP2; EC 2.6.1.96 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
36% identity, 93% coverage: 28:445/449 of query aligns to 71:488/504 of Q94CE5
5kquC Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
37% identity, 98% coverage: 5:445/449 of query aligns to 8:451/459 of 5kquC
5kr6B Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
38% identity, 95% coverage: 12:438/449 of query aligns to 17:446/460 of 5kr6B
5kr3A Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
38% identity, 97% coverage: 5:439/449 of query aligns to 9:444/458 of 5kr3A
5kr5A Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
39% identity, 95% coverage: 12:438/449 of query aligns to 13:442/455 of 5kr5A
Sites not aligning to the query:
6s4gA Crystal structure of the omega transaminase from chromobacterium violaceum in complex with pmp (see paper)
35% identity, 97% coverage: 14:447/449 of query aligns to 15:443/453 of 6s4gA
7q9xAAA Probable aminotransferase
35% identity, 97% coverage: 14:447/449 of query aligns to 16:444/455 of 7q9xAAA
4a6tC Crystal structure of the omega transaminase from chromobacterium violaceum in complex with plp (see paper)
35% identity, 97% coverage: 14:447/449 of query aligns to 16:444/455 of 4a6tC
7ypmA Crystal structure of transaminase cc1012 complexed with plp and l- alanine (see paper)
38% identity, 95% coverage: 22:449/449 of query aligns to 25:448/454 of 7ypmA
6g4dB Crystal structure of the omega transaminase from pseudomonas jessenii in complex with plp (see paper)
36% identity, 97% coverage: 14:448/449 of query aligns to 13:445/453 of 6g4dB
6g4fA Crystal structure of the omega transaminase from pseudomonas jessenii in complex with pmp (see paper)
36% identity, 97% coverage: 14:448/449 of query aligns to 13:445/451 of 6g4fA
6g4eA Crystal structure of the omega transaminase from pseudomonas jessenii in complex with plp and 6-aminohexanoate (6-aca) (see paper)
36% identity, 97% coverage: 14:448/449 of query aligns to 13:445/451 of 6g4eA
7ypnD Crystal structure of transaminase cc1012 mutant m9 complexed with plp (see paper)
38% identity, 95% coverage: 22:449/449 of query aligns to 25:448/455 of 7ypnD
3fcrA Crystal structure of putative aminotransferase (yp_614685.1) from silicibacter sp. Tm1040 at 1.80 a resolution
36% identity, 96% coverage: 9:438/449 of query aligns to 13:446/458 of 3fcrA
>AO356_28705 AO356_28705 hypothetical protein
MYEHYKTAQKKFWHPMSSSAPANRSKTLIIARGDGNYITDIEGHRMLDGVGGLWNVNVGH
NRPSVKAAIAAQLDELAYYQTFDGIAHPRVFDLAERLTSMFAQENMARVLFSSGGSDAVE
TALKMARQYWIASGEPGRTRFLSLRNGYHGVHVGGTSVGGNGVYHYNHGPLLAGCHLLDT
PWLYRNPWDCRDPEELTAHCIRQLEDQIALLGPQTIAALIAEPVQGAGGVIVPPAHYWKR
LREVCDRHGILLIADEVVTGFGRTGCMLGSRGWGVAPDVLCLAKGITAGYIPMGATVFNQ
RIADAIENGPGFSSVIMHGYTYSGHPTACAAALAVLDIVEAEDLPGNAGKVGAQLLEQLQ
PLTERYAVVGEVRGKGLMIAVDLVADKVTREPLDPANGLASRIAEQARRAGVLVRPIGNK
IVMSPPLTLTSDEAAMMVGALDGALADCR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory