SitesBLAST – Find functional sites

 

SitesBLAST

Comparing AO356_28735 FitnessBrowser__pseudo5_N2C3_1:AO356_28735 to proteins with known functional sites using BLASTp with E ≤ 0.001.

Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures

Found 20 (the maximum) hits to proteins with known functional sites (download)

8gstC Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Pyruvate bound-form) (see paper)
54% identity, 98% coverage: 2:276/282 of query aligns to 7:276/290 of 8gstC

query
sites
8gstC
K
 
K
L
 
F
L
 
C
R
 
R
Y
 
F
G
 
G
E
 
Q
K
 
R
G
 
G
S
 
Q
E
 
E
K
 
K
P
 
P
G
 
G
L
 
I
L
 
I
D
 
D
T
 
A
D
 
D
N
 
G
Q
 
N
L
 
I
R
 
R
D
 
D
L
 
L
S
 
S
G
 
G
R
 
V
V
 
V
P
 
P
D
 
E
I
 
-
A
 
-
G
 
-
Q
 
-
V
 
-
L
 
L
G
 
T
A
 
I
D
 
D
S
 
A
L
 
L
A
 
A
A
 
A
L
 
A
A
 
K
A
 
G
L
 
A
D
 
D
P
 
I
R
 
A
S
 
L
L
 
L
P
 
P
L
 
L
V
 
V
A
 
E
G
 
G
Q
 
E
P
 
P
R
 
R
I
 
Y
G
 
G
A
 
V
C
 
P
V
 
V
G
 
K
Q
 
G
V
 
I
G
 
G
K
 
K
F
 
I
I
 
V
C
 
A
I
|
I
G
|
G
L
 
L
N
 
N
Y
 
Y
A
 
E
D
 
D
H
|
H
A
 
A
A
 
I
E
 
E
S
 
S
N
 
N
M
 
L
E
 
P
V
 
I
P
 
P
K
 
T
E
 
E
P
 
P
I
 
M
I
 
M
F
 
F
N
 
M
K
 
K
W
 
A
T
 
L
S
 
S
A
 
S
I
 
L
C
 
N
G
 
G
P
 
P
N
 
N
D
 
D
D
 
E
I
 
V
Q
 
V
I
 
L
P
 
P
R
 
K
G
 
N
S
 
S
L
 
T
K
 
H
T
 
G
D
 
D
W
 
W
E
|
E
V
 
V
E
|
E
L
 
L
G
 
G
V
 
V
V
 
V
I
 
I
G
 
G
K
 
E
G
 
T
G
 
C
R
 
R
Y
 
F
I
 
V
D
 
S
E
 
E
A
 
D
N
 
E
A
 
A
M
 
L
E
 
S
H
 
K
V
 
V
A
 
A
G
 
G
Y
 
Y
C
 
V
V
 
L
I
 
V
N
 
N
D
|
D
V
 
V
S
 
S
E
 
E
R
 
R
E
 
F
W
 
N
Q
 
Q
L
 
K
E
 
Q
R
 
R
G
 
G
G
 
T
T
 
Q
W
 
W
D
 
S
K
 
K
G
 
G
K
|
K
G
 
G
F
 
H
D
 
D
T
 
T
F
 
F
G
 
C
P
 
P
L
 
V
G
 
G
P
 
P
W
 
W
L
 
L
V
 
V
T
 
T
R
 
P
D
 
D
E
 
E
I
 
V
A
 
G
D
 
D
P
 
P
H
 
Q
T
 
D
L
 
L
D
 
D
L
 
V
W
 
H
L
 
L
E
 
D
V
 
V
D
 
N
G
 
G
H
 
E
R
 
R
Y
 
M
Q
 
Q
N
 
T
G
 
G
N
 
N
T
 
T
R
 
K
T
 
T
L
 
M
I
 
I
F
 
F
S
 
N
V
 
V
P
 
A
Q
 
Q
L
 
L
I
 
I
A
 
S
Y
 
Y
L
 
V
S
 
S
R
 
E
C
 
Y
M
 
I
S
 
T
L
 
L
Q
 
Y
P
 
P
G
 
G
D
 
D
V
 
L
I
 
M
S
 
I
T
 
T
G
|
G
T
 
T
P
 
P
P
 
P
G
 
G
V
 
V
G
 
G
L
 
E
G
 
G
I
 
K
K
 
K
P
 
P
A
 
Q
P
 
A
V
 
I
F
 
Y
L
 
L
R
 
K
P
 
A
G
 
G
Q
 
D
T
 
V
I
 
M
R
 
E
L
 
L
G
 
G
I
 
I
E
 
E
G
 
K
L
 
L
G
 
G
E
 
T
Q
 
Q
R
 
R
Q
 
Q

8gsrA Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Apo-form) (see paper)
54% identity, 98% coverage: 2:276/282 of query aligns to 7:276/290 of 8gsrA

query
sites
8gsrA
K
 
K
L
 
F
L
 
C
R
 
R
Y
 
F
G
 
G
E
 
Q
K
 
R
G
 
G
S
 
Q
E
 
E
K
 
K
P
 
P
G
 
G
L
 
I
L
 
I
D
 
D
T
 
A
D
 
D
N
 
G
Q
 
N
L
 
I
R
 
R
D
 
D
L
 
L
S
 
S
G
 
G
R
 
V
V
 
V
P
 
P
D
 
E
I
 
-
A
 
-
G
 
-
Q
 
-
V
 
-
L
 
L
G
 
T
A
 
I
D
 
D
S
 
A
L
 
L
A
 
A
A
 
A
L
 
A
A
 
K
A
 
G
L
 
A
D
 
D
P
 
I
R
 
A
S
 
L
L
 
L
P
 
P
L
 
L
V
 
V
A
 
E
G
 
G
Q
 
E
P
 
P
R
 
R
I
 
Y
G
 
G
A
 
V
C
 
P
V
 
V
G
 
K
Q
 
G
V
 
I
G
 
G
K
 
K
F
 
I
I
 
V
C
 
A
I
 
I
G
 
G
L
 
L
N
 
N
Y
 
Y
A
 
E
D
 
D
H
 
H
A
 
A
A
 
I
E
 
E
S
 
S
N
 
N
M
 
L
E
 
P
V
 
I
P
 
P
K
 
T
E
 
E
P
 
P
I
 
M
I
 
M
F
 
F
N
 
M
K
 
K
W
 
A
T
 
L
S
 
S
A
 
S
I
 
L
C
 
N
G
 
G
P
 
P
N
 
N
D
 
D
D
 
E
I
 
V
Q
 
V
I
 
L
P
 
P
R
 
K
G
 
N
S
 
S
L
 
T
K
 
H
T
 
G
D
 
D
W
 
W
E
|
E
V
 
V
E
|
E
L
 
L
G
 
G
V
 
V
V
 
V
I
 
I
G
 
G
K
 
E
G
 
T
G
 
C
R
 
R
Y
 
F
I
 
V
D
 
S
E
 
E
A
 
D
N
 
E
A
 
A
M
 
L
E
 
S
H
 
K
V
 
V
A
 
A
G
 
G
Y
 
Y
C
 
V
V
 
L
I
 
V
N
 
N
D
|
D
V
 
V
S
 
S
E
 
E
R
 
R
E
 
F
W
 
N
Q
 
Q
L
 
K
E
 
Q
R
 
R
G
 
G
G
 
T
T
 
Q
W
 
W
D
 
S
K
 
K
G
 
G
K
 
K
G
 
G
F
 
H
D
 
D
T
 
T
F
 
F
G
 
C
P
 
P
L
 
V
G
 
G
P
 
P
W
 
W
L
 
L
V
 
V
T
 
T
R
 
P
D
 
D
E
 
E
I
 
V
A
 
G
D
 
D
P
 
P
H
 
Q
T
 
D
L
 
L
D
 
D
L
 
V
W
 
H
L
 
L
E
 
D
V
 
V
D
 
N
G
 
G
H
 
E
R
 
R
Y
 
M
Q
 
Q
N
 
T
G
 
G
N
 
N
T
 
T
R
 
K
T
 
T
L
 
M
I
 
I
F
 
F
S
 
N
V
 
V
P
 
A
Q
 
Q
L
 
L
I
 
I
A
 
S
Y
 
Y
L
 
V
S
 
S
R
 
E
C
 
Y
M
 
I
S
 
T
L
 
L
Q
 
Y
P
 
P
G
 
G
D
 
D
V
 
L
I
 
M
S
 
I
T
 
T
G
 
G
T
 
T
P
 
P
P
 
P
G
 
G
V
 
V
G
 
G
L
 
E
G
 
G
I
 
K
K
 
K
P
 
P
A
 
Q
P
 
A
V
 
I
F
 
Y
L
 
L
R
 
K
P
 
A
G
 
G
Q
 
D
T
 
V
I
 
M
R
 
E
L
 
L
G
 
G
I
 
I
E
 
E
G
 
K
L
 
L
G
 
G
E
 
T
Q
 
Q
R
 
R
Q
 
Q

6v77B Crystal structure of a putative hpce protein from mycobacterium smegmatis
47% identity, 80% coverage: 57:282/282 of query aligns to 49:279/279 of 6v77B

query
sites
6v77B
V
 
T
A
 
A
G
 
A
Q
 
L
P
 
P
R
 
A
I
 
P
G
 
S
A
 
A
C
 
R
V
 
V
G
 
G
Q
 
T
V
 
I
G
 
G
-
 
S
-
 
P
-
 
A
-
 
P
-
 
L
-
 
P
-
 
R
K
 
Q
F
 
V
I
 
F
C
 
A
I
 
V
G
 
G
L
 
L
N
 
N
Y
 
Y
A
 
D
D
 
D
H
 
H
A
 
A
A
 
T
E
 
E
S
 
S
N
 
G
M
 
L
E
 
S
V
 
K
P
 
P
K
 
E
E
 
H
P
 
P
I
 
V
I
 
I
F
 
F
N
 
T
K
 
K
W
 
F
T
 
V
S
 
S
A
 
S
I
 
I
C
 
T
G
 
G
P
 
P
N
 
V
D
 
E
D
 
T
I
 
V
Q
 
Q
I
 
L
P
 
P
R
 
A
G
 
G
S
 
S
L
 
V
K
 
-
T
 
-
D
 
D
W
 
W
E
|
E
V
 
V
E
|
E
L
 
L
G
 
V
V
 
V
V
 
V
I
 
M
G
 
G
K
 
R
G
 
G
G
 
G
R
 
R
Y
 
N
I
 
I
D
 
P
E
 
E
A
 
D
N
 
R
A
 
A
M
 
W
E
 
E
H
 
F
V
 
V
A
 
A
G
 
G
Y
 
V
C
 
S
V
 
V
I
 
G
N
 
Q
D
|
D
V
 
L
S
 
S
E
 
E
R
 
R
E
 
D
W
 
L
Q
 
Q
L
 
L
E
 
A
-
 
G
R
 
P
G
 
A
G
 
P
T
 
Q
W
 
F
D
 
S
K
 
L
G
 
A
K
 
K
G
 
S
F
 
H
D
 
A
T
 
G
F
 
F
G
 
S
P
 
P
L
 
I
G
 
G
P
 
P
W
 
E
L
 
L
V
 
V
T
 
T
R
 
V
D
 
D
E
 
E
I
 
L
A
 
P
D
 
D
P
 
P
H
 
D
T
 
D
L
 
L
D
 
E
L
 
L
W
 
G
L
 
A
E
 
E
V
 
I
D
 
N
G
 
G
H
 
E
R
 
T
Y
 
V
Q
 
Q
N
 
H
G
 
S
N
 
R
T
 
T
R
 
S
T
 
Q
L
 
L
I
 
I
F
 
F
S
 
P
V
 
V
P
 
S
Q
 
N
L
 
L
I
 
I
A
 
A
Y
 
Y
L
 
L
S
 
S
R
 
D
C
 
T
M
 
V
S
 
E
L
 
L
Q
 
Y
P
 
P
G
 
G
D
 
D
V
 
V
I
 
I
S
 
F
T
 
T
G
 
G
T
 
T
P
 
P
P
 
S
G
 
G
V
 
V
G
 
G
L
 
M
G
 
G
I
 
R
K
 
N
P
 
P
A
 
K
P
 
-
V
 
R
F
 
F
L
 
L
R
 
A
P
 
P
G
 
G
Q
 
D
T
 
E
I
 
L
R
 
R
L
 
T
G
 
Y
I
 
I
E
 
T
G
 
G
L
 
V
G
 
G
E
 
E
Q
 
F
R
 
T
Q
 
Q
V
 
R
T
 
F
V
 
V
Q
 
T
A
 
A
D
 
D

8sutA Crystal structure of yisk from bacillus subtilis in complex with reaction product 4-hydroxy-2-oxoglutaric acid (see paper)
41% identity, 71% coverage: 73:272/282 of query aligns to 95:295/303 of 8sutA

query
sites
8sutA
F
 
I
I
 
I
C
 
C
I
|
I
G
|
G
L
x
K
N
 
N
Y
 
Y
A
 
R
D
 
D
H
|
H
A
 
A
A
 
I
E
 
E
-
 
M
-
 
G
S
 
S
N
 
E
M
 
A
E
 
D
V
 
I
P
 
P
K
 
E
E
 
H
P
 
P
I
 
M
I
 
V
F
|
F
N
 
T
K
 
K
W
 
S
T
 
P
S
 
V
A
 
T
I
 
V
C
 
T
G
 
G
P
 
H
N
 
G
D
 
D
D
 
I
I
 
V
Q
 
K
I
 
S
P
 
H
R
 
E
G
 
E
-
 
V
S
 
T
L
 
S
K
 
Q
T
 
L
D
 
D
W
 
Y
E
|
E
V
 
G
E
|
E
L
 
L
G
 
A
V
 
V
V
 
V
I
 
I
G
 
G
K
 
K
G
 
S
G
 
G
R
 
T
Y
 
R
I
 
I
D
 
S
E
 
K
A
 
E
N
 
D
A
 
A
M
 
Y
E
 
D
H
 
H
V
 
V
A
 
F
G
 
G
Y
 
Y
C
 
T
V
 
I
I
 
V
N
 
N
D
|
D
V
 
I
S
 
T
E
 
A
R
|
R
E
 
D
W
 
L
Q
|
Q
L
 
-
E
 
K
R
 
R
G
 
H
G
 
K
T
 
Q
W
 
F
D
 
F
K
 
I
G
 
G
K
|
K
G
 
S
F
 
L
D
 
D
T
 
T
F
 
T
G
 
C
P
 
P
L
 
M
G
 
G
P
 
P
W
 
V
L
 
L
V
 
V
T
 
H
R
 
K
D
 
S
E
 
S
I
 
I
A
 
Q
D
 
E
P
 
P
H
 
E
T
 
R
L
 
L
D
 
K
L
 
V
W
 
E
L
 
T
E
 
R
V
 
V
D
 
N
G
 
G
H
 
E
R
 
L
Y
 
R
Q
 
Q
N
 
S
G
 
G
N
 
S
T
 
A
R
 
S
T
 
D
L
 
M
I
 
I
F
 
F
S
 
S
V
 
I
P
 
P
Q
 
E
L
 
L
I
 
I
A
 
E
Y
 
T
L
 
L
S
 
S
R
 
K
C
 
G
M
 
M
S
 
T
L
 
L
Q
 
E
P
 
A
G
 
G
D
 
D
V
 
I
I
 
I
S
 
A
T
 
T
G
|
G
T
|
T
P
 
P
P
 
S
G
 
G
V
 
V
G
 
G
L
 
K
G
 
G
I
 
F
K
 
T
P
 
P
A
 
-
P
 
P
V
 
K
F
 
F
L
 
L
R
 
R
P
 
S
G
 
G
Q
 
D
T
 
K
I
 
I
R
 
D
L
 
I
G
 
T
I
 
I
E
 
D
G
 
P
L
 
I
G
 
G

8skyB Crystal structure of yisk from bacillus subtilis in complex with oxalate (see paper)
41% identity, 71% coverage: 73:272/282 of query aligns to 94:294/303 of 8skyB

query
sites
8skyB
F
 
I
I
 
I
C
 
C
I
|
I
G
|
G
L
 
K
N
 
N
Y
 
Y
A
 
R
D
 
D
H
|
H
A
 
A
A
 
I
E
 
E
-
 
M
-
 
G
S
 
S
N
 
E
M
 
A
E
 
D
V
 
I
P
 
P
K
 
E
E
 
H
P
 
P
I
 
M
I
 
V
F
 
F
N
 
T
K
 
K
W
 
S
T
 
P
S
 
V
A
 
T
I
 
V
C
 
T
G
 
G
P
 
H
N
 
G
D
 
D
D
 
I
I
 
V
Q
 
K
I
 
S
P
 
H
R
 
E
G
 
E
-
 
V
S
 
T
L
 
S
K
 
Q
T
 
L
D
 
D
W
 
Y
E
|
E
V
 
G
E
|
E
L
 
L
G
 
A
V
 
V
V
 
V
I
 
I
G
 
G
K
 
K
G
 
S
G
 
G
R
 
T
Y
 
R
I
 
I
D
 
S
E
 
K
A
 
E
N
 
D
A
 
A
M
 
Y
E
 
D
H
 
H
V
 
V
A
 
F
G
 
G
Y
 
Y
C
 
T
V
 
I
I
 
V
N
 
N
D
|
D
V
 
I
S
 
T
E
 
A
R
 
R
E
 
D
W
 
L
Q
 
Q
L
 
-
E
 
K
R
 
R
G
 
H
G
 
K
T
 
Q
W
 
F
D
 
F
K
 
I
G
 
G
K
|
K
G
 
S
F
 
L
D
 
D
T
 
T
F
 
T
G
 
C
P
 
P
L
 
M
G
 
G
P
 
P
W
 
V
L
 
L
V
 
V
T
 
H
R
 
K
D
 
S
E
 
S
I
 
I
A
 
Q
D
 
E
P
 
P
H
 
E
T
 
R
L
 
L
D
 
K
L
 
V
W
 
E
L
 
T
E
 
R
V
 
V
D
 
N
G
 
G
H
 
E
R
 
L
Y
 
R
Q
 
Q
N
 
S
G
 
G
N
 
S
T
 
A
R
 
S
T
 
D
L
 
M
I
 
I
F
 
F
S
 
S
V
 
I
P
 
P
Q
 
E
L
 
L
I
 
I
A
 
E
Y
 
T
L
 
L
S
 
S
R
 
K
C
 
G
M
 
M
S
 
T
L
 
L
Q
 
E
P
 
A
G
 
G
D
 
D
V
 
I
I
 
I
S
 
A
T
 
T
G
|
G
T
|
T
P
 
P
P
 
S
G
 
G
V
 
V
G
 
G
L
 
K
G
 
G
I
 
F
K
 
T
P
 
P
A
 
-
P
 
P
V
 
K
F
 
F
L
 
L
R
 
R
P
 
S
G
 
G
Q
 
D
T
 
K
I
 
I
R
 
D
L
 
I
G
 
T
I
 
I
E
 
D
G
 
P
L
 
I
G
 
G

6iymA Fumarylacetoacetate hydrolase (eafah) from psychrophilic exiguobacterium antarcticum (see paper)
36% identity, 98% coverage: 1:277/282 of query aligns to 2:274/277 of 6iymA

query
sites
6iymA
M
 
M
K
 
K
L
 
W
L
 
F
R
 
R
Y
 
F
G
 
E
E
 
Q
K
 
D
G
 
G
S
 
R
E
 
A
K
 
R
P
 
I
G
 
G
L
 
V
L
 
E
D
 
E
T
 
-
D
 
-
N
 
-
Q
 
-
L
 
-
R
 
-
D
 
-
L
 
-
S
 
A
G
 
G
R
 
H
V
 
R
P
 
Y
D
 
D
I
 
V
A
 
T
G
 
P
Q
 
Q
V
 
V
L
 
Y
G
 
-
A
 
T
D
 
D
S
 
S
L
 
L
A
 
L
A
 
E
L
 
V
A
 
I
A
 
V
-
 
R
-
 
G
-
 
F
-
 
E
-
 
M
-
 
D
L
 
V
D
 
D
P
 
L
R
 
D
S
 
V
L
 
A
P
 
P
L
 
R
V
 
L
A
 
T
G
 
D
Q
 
H
P
 
V
R
 
R
I
 
L
G
 
L
A
 
A
C
 
P
V
 
Y
G
 
L
Q
 
P
V
 
P
G
 
R
K
 
N
F
 
V
I
 
I
C
 
C
I
 
V
G
 
G
L
 
K
N
 
N
Y
 
Y
A
 
A
D
 
D
H
 
H
A
 
I
A
 
K
E
 
E
S
 
M
N
 
D
M
 
T
E
 
A
V
 
G
P
 
A
K
 
G
E
 
K
P
 
F
I
 
V
I
 
L
F
 
F
N
 
T
K
 
K
W
 
A
T
 
P
S
 
S
A
 
S
I
 
I
C
 
V
G
 
G
P
 
P
N
 
F
D
 
D
D
 
P
I
 
I
Q
 
E
I
 
R
P
 
H
R
 
A
G
 
D
-
 
L
S
 
T
L
 
Q
K
 
Q
T
 
L
D
 
D
W
 
Y
E
|
E
V
 
G
E
|
E
L
 
L
G
 
A
V
 
I
V
 
I
I
 
I
G
 
G
K
 
T
G
 
T
G
 
G
R
 
R
Y
 
D
I
 
L
D
 
T
E
 
P
A
 
E
N
 
N
A
 
A
M
 
L
E
 
E
H
 
H
V
 
V
A
 
F
G
 
G
Y
 
Y
C
 
S
V
 
I
I
 
I
N
 
N
D
|
D
V
 
V
S
 
T
E
 
A
R
 
R
E
 
D
W
 
L
Q
 
Q
L
 
K
E
 
E
R
 
H
G
 
V
G
 
Q
T
 
F
W
 
F
D
 
-
K
 
R
G
 
G
K
 
K
G
 
S
F
 
L
D
 
D
T
 
G
F
 
F
G
 
C
P
 
P
L
 
F
G
 
G
P
 
P
W
 
V
L
 
I
V
 
V
T
 
T
R
 
E
D
 
D
E
 
A
I
 
F
A
 
-
D
 
D
P
 
P
H
 
A
T
 
D
L
 
V
D
 
L
L
 
V
W
 
E
L
 
T
E
 
R
V
 
V
D
 
N
G
 
G
H
 
E
R
 
L
Y
 
R
Q
 
Q
N
 
S
G
 
G
N
 
S
T
 
T
R
 
K
T
 
L
L
 
M
I
 
L
F
 
R
S
 
D
V
 
V
P
 
V
Q
 
T
L
 
I
I
 
L
A
 
T
Y
 
E
L
 
V
S
 
S
R
 
R
C
 
G
M
 
M
S
 
T
L
 
L
Q
 
E
P
 
A
G
 
G
D
 
D
V
 
V
I
 
I
S
 
A
T
 
T
G
 
G
T
 
T
P
 
P
P
 
A
G
 
G
V
 
V
G
 
G
L
 
H
G
 
G
I
 
M
K
 
K
P
 
P
A
 
-
P
 
P
V
 
V
F
 
Y
L
 
L
R
 
Q
P
 
D
G
 
G
Q
 
D
T
 
V
I
 
I
R
 
D
L
 
V
G
 
S
I
 
I
E
 
E
G
 
G
L
 
I
G
 
G
E
 
H
-
 
L
Q
 
Q
R
 
N
Q
 
Q
V
 
V

6j5xB Crystal structure of fumarylpyruvate hydrolase from corynebacterium glutamicum in complex with mn2+ and pyruvate (see paper)
37% identity, 77% coverage: 62:279/282 of query aligns to 59:277/280 of 6j5xB

query
sites
6j5xB
R
 
E
I
 
L
G
 
D
A
 
A
C
 
V
V
 
V
G
 
P
Q
 
A
V
 
P
G
 
K
K
 
K
F
 
I
I
 
V
C
 
C
I
x
V
G
|
G
L
 
L
N
 
N
Y
 
Y
A
 
A
D
 
N
H
|
H
A
 
I
A
 
K
E
 
E
S
 
M
N
 
G
M
 
R
E
 
D
V
 
L
P
 
P
K
 
D
E
 
T
P
 
P
I
 
T
I
 
L
F
|
F
N
 
V
K
 
K
W
 
F
T
 
P
S
 
D
A
 
A
I
 
L
C
 
I
G
 
G
P
 
P
N
 
F
D
 
D
D
 
D
I
 
V
Q
 
V
I
 
V
P
 
P
R
 
E
G
 
W
S
 
A
L
 
N
K
 
K
T
 
A
-
 
L
D
 
D
W
 
W
E
|
E
V
 
G
E
|
E
L
 
M
G
 
A
V
 
V
V
 
I
I
 
I
G
 
G
K
 
K
G
 
R
G
 
A
R
 
R
Y
 
R
I
 
V
D
 
K
E
 
Q
A
 
A
N
 
D
A
 
A
M
 
A
E
 
E
H
 
Y
V
 
I
A
 
A
G
 
G
Y
 
Y
C
 
A
V
 
V
I
 
M
N
 
N
D
|
D
V
 
Y
S
 
T
E
 
T
R
 
R
E
 
D
W
 
F
Q
 
Q
L
 
Y
-
 
A
-
 
A
-
 
P
E
 
A
R
 
K
G
 
T
G
 
P
T
 
Q
W
|
W
D
 
H
K
 
Q
G
 
G
K
|
K
G
 
S
F
 
L
D
 
E
T
 
K
F
 
S
G
 
A
P
 
G
L
 
F
G
 
G
P
 
P
W
 
W
L
 
M
V
 
T
T
 
T
R
 
P
D
 
D
E
 
S
I
 
F
A
 
E
D
 
F
P
 
G
H
 
G
T
 
E
L
 
L
D
 
A
L
 
T
W
 
Y
L
 
L
E
 
E
V
 
-
D
 
-
G
 
G
H
 
E
R
 
K
Y
 
V
Q
 
Q
N
 
S
G
 
T
N
 
P
T
 
T
R
 
N
T
 
D
L
 
L
I
 
V
F
 
F
S
 
S
V
 
P
P
 
E
Q
 
K
L
 
L
I
 
I
A
 
E
Y
 
Y
L
 
I
S
 
T
R
 
H
C
 
I
M
 
Y
S
 
P
L
 
L
Q
 
D
P
 
A
G
 
G
D
 
D
V
 
V
I
 
I
S
 
V
T
 
T
G
|
G
T
|
T
P
 
P
P
 
G
G
 
G
V
 
V
G
 
G
L
 
H
G
 
A
I
 
R
K
 
N
P
 
P
A
 
Q
P
 
R
V
 
-
F
 
Y
L
 
I
R
 
G
P
 
D
G
 
G
Q
 
E
T
 
T
I
 
V
R
 
K
L
 
V
G
 
E
I
 
I
E
 
A
G
 
G
L
 
L
G
 
G
E
 
F
Q
 
I
R
 
E
Q
 
N
V
 
K
T
 
T
V
 
V

6j5xA Crystal structure of fumarylpyruvate hydrolase from corynebacterium glutamicum in complex with mn2+ and pyruvate (see paper)
37% identity, 77% coverage: 62:279/282 of query aligns to 59:277/280 of 6j5xA

query
sites
6j5xA
R
 
E
I
 
L
G
 
D
A
 
A
C
 
V
V
 
V
G
 
P
Q
 
A
V
 
P
G
 
K
K
 
K
F
 
I
I
 
V
C
 
C
I
 
V
G
 
G
L
 
L
N
 
N
Y
 
Y
A
 
A
D
 
N
H
 
H
A
 
I
A
 
K
E
 
E
S
 
M
N
 
G
M
 
R
E
 
D
V
 
L
P
 
P
K
 
D
E
 
T
P
 
P
I
 
T
I
 
L
F
 
F
N
 
V
K
 
K
W
 
F
T
 
P
S
 
D
A
 
A
I
 
L
C
 
I
G
 
G
P
 
P
N
 
F
D
 
D
D
 
D
I
 
V
Q
 
V
I
 
V
P
 
P
R
 
E
G
 
W
S
 
A
L
 
N
K
 
K
T
 
A
-
 
L
D
 
D
W
 
W
E
|
E
V
 
G
E
|
E
L
 
M
G
 
A
V
 
V
V
 
I
I
 
I
G
 
G
K
 
K
G
 
R
G
 
A
R
 
R
Y
 
R
I
 
V
D
 
K
E
 
Q
A
 
A
N
 
D
A
 
A
M
 
A
E
 
E
H
 
Y
V
 
I
A
 
A
G
 
G
Y
 
Y
C
 
A
V
 
V
I
 
M
N
 
N
D
|
D
V
 
Y
S
 
T
E
 
T
R
 
R
E
 
D
W
 
F
Q
 
Q
L
 
Y
-
 
A
-
 
A
-
 
P
E
 
A
R
 
K
G
 
T
G
 
P
T
 
Q
W
 
W
D
 
H
K
 
Q
G
 
G
K
 
K
G
 
S
F
 
L
D
 
E
T
 
K
F
 
S
G
 
A
P
 
G
L
 
F
G
 
G
P
 
P
W
 
W
L
 
M
V
 
T
T
 
T
R
 
P
D
 
D
E
 
S
I
 
F
A
 
E
D
 
F
P
 
G
H
 
G
T
 
E
L
 
L
D
 
A
L
 
T
W
 
Y
L
 
L
E
 
E
V
 
-
D
 
-
G
 
G
H
 
E
R
 
K
Y
 
V
Q
 
Q
N
 
S
G
 
T
N
 
P
T
 
T
R
 
N
T
 
D
L
 
L
I
 
V
F
 
F
S
 
S
V
 
P
P
 
E
Q
 
K
L
 
L
I
 
I
A
 
E
Y
 
Y
L
 
I
S
 
T
R
 
H
C
 
I
M
 
Y
S
 
P
L
 
L
Q
 
D
P
 
A
G
 
G
D
 
D
V
 
V
I
 
I
S
 
V
T
 
T
G
 
G
T
 
T
P
 
P
P
 
G
G
 
G
V
 
V
G
 
G
L
 
H
G
 
A
I
 
R
K
 
N
P
 
P
A
 
Q
P
 
R
V
 
-
F
 
Y
L
 
I
R
 
G
P
 
D
G
 
G
Q
 
E
T
 
T
I
 
V
R
 
K
L
 
V
G
 
E
I
 
I
E
 
A
G
 
G
L
 
L
G
 
G
E
 
F
Q
 
I
R
 
E
Q
 
N
V
 
K
T
 
T
V
 
V

3r6oA Crystal structure of a probable 2-hydroxyhepta-2,4-diene-1, 7- dioateisomerase from mycobacterium abscessus (see paper)
34% identity, 85% coverage: 35:275/282 of query aligns to 13:257/265 of 3r6oA

query
sites
3r6oA
G
 
G
Q
 
V
V
 
L
L
 
I
G
 
D
A
 
D
D
 
D
S
 
T
L
 
V
A
 
A
A
 
P
L
 
L
A
 
A
A
 
P
L
 
M
D
 
S
P
 
A
R
 
R
S
 
E
L
 
L
-
 
I
-
 
A
-
 
L
-
 
L
-
 
P
-
 
Q
-
 
I
-
 
S
P
 
P
L
 
L
V
 
I
A
 
S
G
 
D
Q
 
E
-
 
L
-
 
V
-
 
P
-
 
L
-
 
D
-
 
S
P
 
V
R
 
A
I
 
L
G
 
G
A
 
A
C
 
P
V
 
I
G
 
P
Q
 
E
V
 
P
G
 
G
K
 
Q
F
 
V
I
 
I
C
 
A
I
 
L
G
 
G
L
 
F
N
 
N
Y
 
Y
A
 
P
D
 
T
H
 
H
A
 
-
A
 
-
E
 
-
S
 
-
N
 
-
M
 
-
E
 
-
V
 
-
P
 
-
K
 
-
E
 
D
P
 
P
I
 
V
I
 
V
F
 
F
N
 
M
K
 
K
W
 
S
T
 
P
S
 
T
A
 
S
I
 
I
C
 
S
G
 
G
P
 
P
N
 
R
D
 
D
D
 
A
I
 
V
Q
 
I
I
 
A
P
 
P
R
 
R
G
 
T
S
 
S
L
 
H
K
 
A
T
 
L
D
 
D
W
 
Y
E
|
E
V
 
I
E
|
E
L
 
I
G
 
A
V
 
V
V
 
V
I
 
I
G
 
G
K
 
K
G
 
P
G
 
G
R
 
Y
Y
 
R
I
 
I
D
 
E
E
 
R
A
 
S
N
 
Q
A
 
A
M
 
I
E
 
K
H
 
H
V
 
V
A
 
A
G
 
G
Y
 
Y
C
 
M
V
 
L
I
 
A
N
 
N
D
|
D
V
 
I
S
 
T
E
 
A
R
 
R
E
 
D
W
 
V
Q
 
A
L
 
L
E
 
P
R
 
F
G
 
G
-
 
Q
G
 
A
T
 
Q
W
 
V
D
 
V
K
 
R
G
 
G
K
 
K
G
 
G
F
 
Y
D
 
P
T
 
T
F
 
F
G
 
C
P
 
P
L
 
T
G
 
G
P
 
P
W
 
W
L
 
L
V
 
F
T
 
T
R
 
T
D
 
G
E
 
S
I
 
D
A
 
T
D
 
T
P
 
F
H
 
E
T
 
T
L
 
F
D
 
D
L
 
F
W
 
E
L
 
L
E
 
R
V
 
I
D
 
N
G
 
G
H
 
E
R
 
L
Y
 
R
Q
 
Q
N
 
S
G
 
G
N
 
S
T
 
T
R
 
V
T
 
D
L
 
M
I
 
T
F
 
L
S
 
G
V
 
F
P
 
A
Q
 
E
L
 
V
I
 
V
A
 
E
Y
 
T
L
 
V
S
 
S
R
 
A
C
 
T
M
 
I
S
 
A
L
 
L
Q
 
R
P
 
A
G
 
G
D
 
D
V
 
I
I
 
I
S
 
L
T
 
T
G
 
G
T
 
T
P
 
P
P
 
G
G
 
G
V
 
C
G
 
G
L
 
F
G
 
Q
I
 
F
K
 
D
P
 
P
A
 
-
P
 
P
V
 
R
F
 
Y
L
 
L
R
 
R
P
 
P
G
 
G
Q
 
D
T
 
V
I
 
I
R
 
E
L
 
A
G
 
H
I
 
S
E
 
A
G
 
K
L
 
L
G
 
G
E
 
K
Q
 
M
R
 
R

6sbiA X-ray structure of murine fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate (see paper)
39% identity, 72% coverage: 73:275/282 of query aligns to 14:210/216 of 6sbiA

query
sites
6sbiA
F
 
I
I
 
V
C
 
C
I
 
V
G
|
G
L
x
R
N
 
N
Y
 
Y
A
 
A
D
 
D
H
|
H
A
 
V
A
 
K
E
 
E
S
 
M
N
 
R
M
 
S
E
 
T
V
 
V
P
 
L
K
 
S
E
 
E
P
 
P
I
 
V
I
 
L
F
 
F
N
 
L
K
 
K
W
 
P
T
x
S
S
 
T
A
 
A
I
 
Y
C
 
A
G
 
P
P
 
E
N
 
G
D
 
S
D
 
P
I
 
V
Q
 
L
I
 
M
P
 
P
R
 
A
G
 
Y
S
 
C
L
 
R
K
 
N
T
 
L
D
 
H
W
 
H
E
|
E
V
 
V
E
|
E
L
 
L
G
 
G
V
 
V
V
 
L
I
 
L
G
 
G
K
 
K
G
 
R
G
 
G
R
 
E
Y
 
A
I
 
I
D
 
P
E
 
E
A
 
A
N
 
A
A
 
A
M
 
M
E
 
D
H
 
Y
V
 
V
A
 
A
G
 
G
Y
 
Y
C
 
A
V
 
L
I
 
C
N
 
L
D
|
D
V
 
M
S
 
T
E
 
A
R
 
R
E
 
D
W
 
V
Q
 
Q
L
 
E
E
 
E
-
 
C
-
 
K
-
 
K
R
 
K
G
 
G
G
 
L
T
 
P
W
 
W
D
 
T
K
 
L
G
 
A
K
|
K
G
 
S
F
 
F
D
 
T
T
 
S
F
 
S
G
 
C
P
 
P
L
 
V
G
 
S
P
 
A
W
 
F
L
 
-
V
 
V
T
 
P
R
 
K
D
 
E
E
 
K
I
 
I
A
 
P
D
 
D
P
 
P
H
 
H
T
 
A
L
 
L
D
 
R
L
 
L
W
 
W
L
 
L
E
 
K
V
 
V
D
 
N
G
 
G
H
 
E
R
 
L
Y
 
R
Q
 
Q
N
 
E
G
 
G
N
 
K
T
 
T
R
 
S
T
 
S
L
 
M
I
 
I
F
 
F
S
 
S
V
 
I
P
 
P
Q
 
Y
L
 
I
I
 
I
A
 
S
Y
 
Y
L
 
V
S
 
S
R
 
K
C
 
I
M
 
I
S
x
T
L
 
L
Q
 
E
P
 
E
G
 
G
D
 
D
V
 
L
I
 
I
S
 
L
T
 
T
G
 
G
T
 
T
P
 
P
P
 
K
G
 
G
V
|
V
G
 
G
L
 
-
G
 
-
I
 
-
K
 
-
P
 
-
A
 
-
P
 
P
V
 
I
F
 
-
L
 
-
R
 
K
P
 
E
G
 
N
Q
 
D
T
 
E
I
 
I
R
 
E
L
 
A
G
 
G
I
 
I
E
 
D
G
 
G
L
 
V
G
 
V
E
 
S
Q
 
M
R
 
R

Q6P587 Acylpyruvase FAHD1, mitochondrial; Fumarylacetoacetate hydrolase domain-containing protein 1; FAH domain-containing protein 1; Oxaloacetate decarboxylase; OAA decarboxylase; YisK-like protein; EC 3.7.1.5; EC 4.1.1.112 from Homo sapiens (Human) (see 3 papers)
40% identity, 71% coverage: 73:271/282 of query aligns to 17:209/221 of Q6P587

query
sites
Q6P587
F
 
I
I
 
V
C
 
C
I
 
V
G
 
G
L
 
R
N
 
N
Y
 
Y
A
 
A
D
 
D
H
|
H
A
 
V
A
 
R
E
|
E
S
 
M
N
 
R
M
 
S
E
 
A
V
 
V
P
 
L
K
 
S
E
 
E
P
 
P
I
 
V
I
 
L
F
 
F
N
 
L
K
 
K
W
 
P
T
 
S
S
 
T
A
 
A
I
 
Y
C
 
A
G
 
P
P
 
E
N
 
G
D
 
S
D
 
P
I
 
I
Q
 
L
I
 
M
P
 
P
R
 
A
G
 
Y
S
 
T
L
 
R
K
 
N
T
 
L
D
 
H
W
 
H
E
|
E
V
 
L
E
|
E
L
 
L
G
 
G
V
 
V
V
 
V
I
 
M
G
 
G
K
 
K
G
 
R
G
 
C
R
 
R
Y
 
A
I
 
V
D
 
P
E
 
E
A
 
A
N
 
A
A
 
A
M
 
M
E
 
D
H
 
Y
V
 
V
A
 
G
G
 
G
Y
 
Y
C
 
A
V
 
L
I
 
C
N
 
L
D
|
D
V
 
M
S
 
T
E
 
A
R
|
R
E
 
D
W
 
V
Q
 
Q
L
 
D
E
 
E
-
 
C
-
 
K
-
 
K
R
 
K
G
 
G
G
 
L
T
 
P
W
 
W
D
 
T
K
 
L
G
 
A
K
 
K
G
 
S
F
 
F
D
 
T
T
 
A
F
 
S
G
 
C
P
 
P
L
 
V
G
 
S
P
 
A
W
 
F
L
 
-
V
 
V
T
 
P
R
 
K
D
 
E
E
 
K
I
 
I
A
 
P
D
 
D
P
 
P
H
 
H
T
 
K
L
 
L
D
 
K
L
 
L
W
 
W
L
 
L
E
 
K
V
 
V
D
 
N
G
 
G
H
 
E
R
 
L
Y
 
R
Q
 
Q
N
 
E
G
 
G
N
 
E
T
 
T
R
 
S
T
 
S
L
 
M
I
 
I
F
 
F
S
 
S
V
 
I
P
 
P
Q
 
Y
L
 
I
I
 
I
A
 
S
Y
 
Y
L
 
V
S
 
S
R
 
K
C
 
I
M
 
I
S
 
T
L
 
L
Q
 
E
P
 
E
G
 
G
D
 
D
V
 
I
I
 
I
S
 
L
T
 
T
G
 
G
T
 
T
P
 
P
P
 
K
G
 
G
V
 
V
G
 
G
L
 
-
G
 
-
I
 
-
K
 
-
P
 
-
A
 
-
P
 
P
V
 
V
F
 
-
L
 
-
R
 
K
P
 
E
G
 
N
Q
 
D
T
 
E
I
 
I
R
 
E
L
 
A
G
 
G
I
 
I
E
 
H
G
 
G
L
 
L

6fogA X-ray structure of homo sapiens fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate at 1.94a resolution. (see paper)
40% identity, 71% coverage: 73:271/282 of query aligns to 15:207/218 of 6fogA

query
sites
6fogA
F
 
I
I
 
V
C
 
C
I
 
V
G
|
G
L
 
R
N
 
N
Y
 
Y
A
 
A
D
 
D
H
 
H
A
 
V
A
 
R
E
 
E
S
 
M
N
 
R
M
 
S
E
 
A
V
 
V
P
 
L
K
 
S
E
 
E
P
 
P
I
 
V
I
 
L
F
 
F
N
 
L
K
 
K
W
 
P
T
 
S
S
 
T
A
 
A
I
 
Y
C
 
A
G
 
P
P
 
E
N
 
G
D
 
S
D
 
P
I
 
I
Q
 
L
I
 
M
P
 
P
R
 
A
G
 
Y
S
 
T
L
 
R
K
 
N
T
 
L
D
 
H
W
 
H
E
|
E
V
 
L
E
|
E
L
 
L
G
 
G
V
 
V
V
 
V
I
 
M
G
 
G
K
 
K
G
 
R
G
 
C
R
 
R
Y
 
A
I
 
V
D
 
P
E
 
E
A
 
A
N
 
A
A
 
A
M
 
M
E
 
D
H
 
Y
V
 
V
A
 
G
G
 
G
Y
 
Y
C
 
A
V
 
L
I
 
C
N
 
L
D
|
D
V
 
M
S
 
T
E
 
A
R
 
R
E
 
D
W
 
V
Q
 
Q
L
 
D
E
 
E
-
 
C
-
 
K
-
 
K
R
 
K
G
 
G
G
 
L
T
 
P
W
 
W
D
 
T
K
 
L
G
 
A
K
 
K
G
 
S
F
 
F
D
 
T
T
 
A
F
 
S
G
 
C
P
 
P
L
 
V
G
 
S
P
 
A
W
 
F
L
 
-
V
 
V
T
 
P
R
 
K
D
 
E
E
 
K
I
 
I
A
 
P
D
 
D
P
 
P
H
 
H
T
 
K
L
 
L
D
 
K
L
 
L
W
 
W
L
 
L
E
 
K
V
 
V
D
 
N
G
 
G
H
 
E
R
 
L
Y
 
R
Q
 
Q
N
 
E
G
 
G
N
 
E
T
 
T
R
 
S
T
 
S
L
 
M
I
 
I
F
 
F
S
 
S
V
 
I
P
 
P
Q
 
Y
L
 
I
I
 
I
A
 
S
Y
 
Y
L
 
V
S
 
S
R
 
K
C
 
I
M
 
I
S
 
T
L
 
L
Q
 
E
P
 
E
G
 
G
D
 
D
V
 
I
I
 
I
S
 
L
T
 
T
G
 
G
T
|
T
P
 
P
P
 
K
G
 
G
V
 
V
G
 
G
L
 
-
G
 
-
I
 
-
K
 
-
P
 
-
A
 
-
P
 
P
V
 
V
F
 
-
L
 
-
R
 
K
P
 
E
G
 
N
Q
 
D
T
 
E
I
 
I
R
 
E
L
 
A
G
 
G
I
 
I
E
 
H
G
 
G
L
 
L

Sites not aligning to the query:

3qdfA Crystal structure of 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase from mycobacterium marinum (see paper)
38% identity, 71% coverage: 72:272/282 of query aligns to 63:241/252 of 3qdfA

query
sites
3qdfA
K
 
K
F
 
V
I
 
V
C
 
C
I
 
V
G
 
G
L
 
K
N
 
N
Y
 
Y
A
 
T
D
 
-
H
 
-
A
 
-
A
 
-
E
 
-
S
 
-
N
 
-
M
 
-
E
 
-
V
 
-
P
 
P
K
 
A
E
 
D
P
 
P
I
 
V
I
 
I
F
 
F
N
 
L
K
 
K
W
 
P
T
 
N
S
 
T
A
 
A
I
 
I
C
 
V
G
 
G
P
 
P
N
 
N
D
 
V
D
 
P
I
 
I
Q
 
R
I
 
L
P
 
P
R
 
A
G
 
N
S
 
A
L
 
S
K
 
P
T
 
V
D
 
H
W
 
F
E
|
E
V
 
G
E
|
E
L
 
L
G
 
A
V
 
I
V
 
V
I
 
I
G
 
G
K
 
R
G
 
P
G
 
C
R
 
K
Y
 
D
I
 
V
D
 
S
E
 
A
A
 
A
N
 
Q
A
 
A
M
 
V
E
 
D
H
 
N
V
 
I
A
 
L
G
 
G
Y
 
Y
C
 
T
V
 
I
I
 
G
N
 
N
D
|
D
V
 
V
S
 
S
E
 
A
R
 
R
E
 
D
W
 
Q
Q
 
Q
L
 
-
E
 
K
R
 
S
G
 
D
G
 
G
T
 
Q
W
 
W
D
 
T
K
 
R
G
 
A
K
 
K
G
 
G
F
 
H
D
 
D
T
 
T
F
 
F
G
 
C
P
 
P
L
 
V
G
 
G
P
 
P
W
 
W
L
 
I
V
 
V
T
 
T
R
 
D
D
 
-
E
 
-
I
 
-
A
 
V
D
 
D
P
 
P
H
 
A
T
 
D
L
 
L
D
x
E
L
 
L
W
 
R
L
 
T
E
 
E
V
 
V
D
 
N
G
 
G
H
 
A
R
 
V
Y
 
K
Q
 
Q
N
x
H
G
 
A
N
 
R
T
 
T
R
 
S
T
 
L
L
 
M
I
 
I
F
 
H
S
 
D
V
 
V
P
 
G
Q
 
A
L
 
I
I
 
V
A
 
E
Y
 
W
L
 
I
S
 
S
R
 
A
C
 
V
M
 
M
S
 
T
L
 
L
Q
 
L
P
 
P
G
 
G
D
 
D
V
 
L
I
 
I
S
 
L
T
 
T
G
 
G
T
 
T
P
 
P
P
 
A
G
 
G
V
 
V
G
 
G
L
 
P
G
 
-
I
 
-
K
 
-
P
 
-
A
 
-
P
 
-
V
 
-
F
 
-
L
 
I
R
 
E
P
 
D
G
 
G
Q
 
D
T
 
T
I
 
V
R
 
S
L
 
I
G
 
T
I
 
I
E
 
E
G
 
G
L
 
I
G
 
G

1gttA Crystal structure of hpce (see paper)
42% identity, 63% coverage: 71:248/282 of query aligns to 223:392/421 of 1gttA

query
sites
1gttA
G
 
G
K
 
T
F
 
L
I
 
F
C
 
A
I
 
L
G
 
G
L
 
L
N
 
N
Y
 
Y
A
 
A
D
 
D
H
 
H
A
 
-
A
 
-
E
 
-
S
 
-
N
 
-
M
 
-
E
 
-
V
 
-
P
 
P
K
 
E
E
 
E
P
 
P
I
 
L
I
 
V
F
 
F
N
 
L
K
 
K
W
 
A
T
 
P
S
 
N
A
 
T
I
 
L
C
 
T
G
 
G
P
 
D
N
 
N
D
 
Q
D
 
T
I
 
S
Q
 
V
I
 
R
P
 
P
R
 
N
G
 
N
S
 
I
L
 
E
K
 
Y
T
 
M
D
 
H
W
 
Y
E
|
E
V
 
A
E
|
E
L
 
L
G
 
V
V
 
V
V
 
V
I
 
I
G
 
G
K
 
K
G
 
Q
G
 
A
R
 
R
Y
 
N
I
 
V
D
 
S
E
 
E
A
 
A
N
 
D
A
 
A
M
 
M
E
 
D
H
 
Y
V
 
V
A
 
A
G
 
G
Y
 
Y
C
 
T
V
 
V
I
 
C
N
 
N
D
|
D
V
 
Y
S
 
A
E
 
I
R
 
R
E
 
D
W
 
Y
Q
 
L
L
 
E
E
 
N
R
 
Y
G
 
Y
G
 
R
T
 
P
W
 
N
D
 
L
K
 
R
G
 
V
K
 
K
G
 
S
F
 
R
D
 
D
T
 
G
F
 
L
G
 
T
P
 
P
L
 
M
G
 
L
P
 
S
W
 
T
L
 
I
V
 
V
T
 
P
R
 
K
D
 
E
E
 
A
I
 
I
A
 
P
D
 
D
P
 
P
H
 
H
T
 
N
L
 
L
D
 
T
L
 
L
W
 
R
L
 
T
E
 
F
V
 
V
D
 
N
G
 
G
H
 
E
R
 
L
Y
 
R
Q
 
Q
N
 
Q
G
 
G
N
 
T
T
 
T
R
 
A
T
 
D
L
 
L
I
 
I
F
 
F
S
 
S
V
 
V
P
 
P
Q
 
F
L
 
L
I
 
I
A
 
A
Y
 
Y
L
 
L
S
 
S
R
 
E
C
 
F
M
 
M
S
 
T
L
 
L
Q
 
N
P
 
P
G
 
G
D
 
D
V
 
M
I
 
I
S
 
A
T
 
T
G
 
G
T
 
T
P
 
P
P
 
K
G
 
G
V
 
L
G
 
S

4dbhA Crystal structure of cg1458 with inhibitor (see paper)
36% identity, 74% coverage: 72:281/282 of query aligns to 63:269/269 of 4dbhA

query
sites
4dbhA
K
 
K
F
 
V
I
 
V
C
 
A
I
 
I
G
|
G
L
x
R
N
 
N
Y
 
Y
A
 
A
D
 
D
H
|
H
A
 
V
A
 
A
E
 
E
S
 
V
N
 
F
M
 
K
E
 
K
V
 
S
P
 
A
K
 
E
E
 
S
-
 
L
-
 
P
P
 
P
I
 
T
I
 
L
F
|
F
N
 
L
K
 
K
W
 
P
T
 
P
S
 
T
A
 
A
I
 
V
C
 
T
G
 
G
P
 
P
N
 
E
D
 
S
D
 
P
I
 
I
Q
 
R
I
 
I
P
 
P
R
 
S
G
 
F
S
 
A
L
 
T
K
 
K
T
 
V
D
 
E
W
 
F
E
|
E
V
 
G
E
|
E
L
 
L
G
 
A
V
 
V
V
 
V
I
 
I
G
 
G
K
 
K
G
 
P
G
 
C
R
 
K
Y
 
N
I
 
V
D
 
K
E
 
A
A
 
D
N
 
D
A
 
W
M
 
K
E
 
S
H
 
V
V
 
V
A
 
L
G
 
G
Y
 
F
C
 
T
V
 
I
I
 
I
N
 
N
D
|
D
V
 
V
S
 
S
E
 
S
R
 
R
E
 
D
W
 
L
Q
 
Q
L
 
F
E
 
A
R
 
-
G
 
D
G
 
G
T
 
Q
W
 
W
D
 
A
K
 
R
G
 
A
K
|
K
G
 
G
F
 
I
D
 
D
T
 
T
F
 
F
G
 
G
P
 
P
L
 
I
G
 
G
P
 
P
W
 
W
L
 
I
V
 
E
T
 
T
R
 
D
D
 
I
E
 
N
I
 
S
A
 
I
D
 
D
P
 
L
H
 
D
T
 
N
L
 
L
D
 
P
L
 
I
-
 
K
-
 
A
W
 
R
L
 
L
E
 
T
V
 
H
D
 
D
G
 
G
H
 
E
R
 
T
Y
 
Q
-
 
L
-
 
K
Q
 
Q
N
 
D
G
 
S
N
 
N
T
 
S
R
 
N
T
 
Q
L
 
M
I
 
I
F
 
M
S
 
K
V
 
M
P
 
G
Q
 
E
L
 
I
I
 
I
A
 
E
Y
 
F
L
 
I
S
 
T
R
 
A
C
 
S
M
 
M
S
 
T
L
 
L
Q
 
L
P
 
P
G
 
G
D
 
D
V
 
V
I
 
I
S
 
A
T
 
T
G
 
G
T
x
S
P
 
P
P
 
A
G
 
G
V
 
T
G
 
E
L
 
A
G
 
M
I
 
V
K
 
D
P
 
-
A
 
-
P
 
-
V
 
-
F
 
-
L
 
-
R
 
-
P
 
-
G
 
G
Q
 
D
T
 
Y
I
 
I
R
 
E
L
 
I
G
 
E
I
 
I
E
 
P
G
 
G
L
 
I
G
 
G
E
 
K
Q
 
L
R
 
G
Q
 
N
V
 
P
T
 
V
V
 
V
Q
 
D
A
 
A

6j5yA Crystal structure of fumarylpyruvate hydrolase from pseudomonas aeruginosa in complex with mn2+ and pyruvate (see paper)
36% identity, 72% coverage: 70:273/282 of query aligns to 23:225/233 of 6j5yA

query
sites
6j5yA
V
 
V
G
 
R
K
 
R
F
 
V
I
 
Y
C
 
C
I
 
V
G
|
G
L
x
R
N
 
N
Y
 
Y
A
 
A
D
 
A
H
|
H
A
 
A
A
 
R
E
 
E
S
 
M
N
 
G
M
 
F
E
 
D
V
 
P
P
 
E
K
 
R
E
 
E
P
 
P
-
 
P
I
 
F
I
 
F
F
|
F
N
 
C
K
 
K
W
 
P
T
 
A
S
 
D
A
 
A
I
 
V
-
 
V
-
 
P
-
 
V
-
 
A
C
 
A
G
 
G
P
 
S
N
 
T
D
 
L
D
 
E
I
 
L
Q
 
A
I
 
Y
P
 
P
R
 
S
G
 
Q
S
 
T
L
 
G
K
 
N
T
 
Y
D
 
H
W
 
Y
E
|
E
V
 
I
E
|
E
L
 
L
G
 
V
V
 
A
V
 
A
I
 
I
G
 
G
K
 
K
G
 
G
G
 
G
R
 
C
Y
 
D
I
 
I
D
 
P
E
 
L
A
 
E
N
 
Q
A
 
A
M
 
E
E
 
E
H
 
H
V
 
V
A
 
W
G
 
G
Y
 
Y
C
 
A
V
 
V
I
 
G
N
 
L
D
|
D
V
 
M
S
 
T
E
 
R
R
 
R
E
 
D
W
 
L
Q
 
Q
L
 
M
-
 
R
-
 
M
-
 
R
E
 
E
R
 
M
G
 
G
G
 
R
T
 
P
W
 
W
D
 
E
K
 
I
G
 
G
K
|
K
G
 
A
F
 
F
D
 
D
T
 
R
F
 
S
G
 
A
P
 
P
L
 
I
G
 
G
P
 
P
W
 
-
L
 
L
V
 
Y
T
 
P
R
 
A
D
 
S
E
 
Q
I
 
V
A
 
G
D
 
H
P
 
P
H
 
R
T
 
H
L
 
A
D
 
A
L
 
I
W
 
S
L
 
L
E
 
Q
V
 
V
D
 
D
G
 
G
H
 
E
R
 
D
Y
 
R
Q
 
Q
N
 
R
G
 
S
N
 
D
T
 
I
R
 
D
T
 
Q
L
 
L
I
 
I
F
 
W
S
 
S
V
 
V
P
 
A
Q
 
E
L
 
T
I
 
V
A
 
S
Y
 
Y
L
 
L
S
 
S
R
 
R
C
 
F
M
 
F
S
 
E
L
 
L
Q
 
R
P
 
P
G
 
G
D
 
D
V
 
L
I
 
V
S
 
F
T
 
T
G
 
G
T
|
T
P
 
P
P
 
E
G
 
G
V
 
V
G
 
G
L
 
A
G
 
-
I
 
-
K
 
-
P
 
-
A
 
-
P
 
-
V
 
-
F
 
-
L
 
V
R
 
E
P
 
R
G
 
G
Q
 
E
T
 
R
I
 
M
R
 
L
L
 
G
G
 
A
I
 
I
E
 
D
G
 
G
L
 
L
G
 
G
E
 
E

3v77A Crystal structure of a putative fumarylacetoacetate isomerase/hydrolase from oleispira antarctica (see paper)
36% identity, 63% coverage: 70:248/282 of query aligns to 15:197/224 of 3v77A

query
sites
3v77A
V
 
L
G
 
G
K
 
K
F
 
I
I
 
V
C
 
C
I
 
V
G
 
G
L
 
R
N
 
N
Y
 
Y
A
 
A
D
 
A
H
 
H
A
 
A
A
 
K
E
 
E
S
 
L
N
 
N
M
 
N
E
 
P
V
 
I
P
 
P
K
 
S
E
 
S
P
 
P
I
 
I
I
 
L
F
 
F
N
 
I
K
 
K
W
 
P
T
 
A
S
 
S
A
 
S
I
 
A
C
 
V
G
 
P
P
 
F
N
 
G
D
 
P
D
 
V
I
 
F
Q
 
S
I
 
I
P
 
P
R
 
K
G
 
D
S
 
Q
L
 
G
K
 
S
T
 
V
D
 
H
W
 
H
E
 
E
V
 
L
E
|
E
L
 
I
G
 
A
V
 
I
V
 
L
I
 
I
G
 
G
K
 
K
G
 
A
G
 
L
R
 
S
Y
 
R
I
 
A
D
 
S
E
 
T
A
 
E
N
 
Q
A
 
V
M
 
A
E
 
E
H
 
S
V
 
I
A
 
A
G
 
G
Y
 
I
C
 
G
V
 
L
I
 
G
N
 
L
D
|
D
V
 
L
S
 
T
E
 
L
R
 
R
E
 
D
W
 
V
Q
 
Q
-
 
D
-
 
Q
-
 
L
L
 
K
E
 
E
R
 
K
G
 
G
G
 
H
T
 
P
W
 
W
D
 
E
K
 
R
G
 
A
K
 
K
G
 
S
F
 
F
D
 
D
T
 
G
F
 
A
G
 
C
P
 
P
L
 
L
G
 
T
P
 
E
W
 
F
L
 
V
V
 
A
T
 
V
R
 
N
D
 
L
E
 
A
I
 
S
A
 
E
D
 
D
P
 
E
-
 
W
H
 
Q
T
 
A
L
 
I
D
 
G
L
 
L
W
 
T
L
 
L
E
 
E
V
 
K
D
 
N
G
 
G
H
 
Q
R
 
F
Y
 
Q
Q
 
Q
N
 
Q
G
 
G
N
 
S
T
 
S
R
 
A
T
 
E
L
 
M
I
 
L
F
 
F
S
 
P
V
 
I
P
 
L
Q
 
P
L
 
L
I
 
I
A
 
A
Y
x
H
L
 
M
S
 
S
R
 
E
C
x
H
M
 
F
S
 
S
L
 
L
Q
 
Q
P
 
P
G
 
G
D
 
D
V
 
V
I
 
I
S
 
L
T
 
T
G
 
G
T
 
T
P
 
P
P
 
A
G
 
G
V
 
V
G
 
G

6jvwB Crystal structure of maleylpyruvate hydrolase from sphingobium sp. Syk-6 in complex with manganese (ii) ion and pyruvate (see paper)
36% identity, 74% coverage: 72:280/282 of query aligns to 78:262/264 of 6jvwB

query
sites
6jvwB
K
 
K
F
 
I
I
 
I
C
 
A
I
 
Y
G
 
P
L
x
V
N
 
N
Y
 
Y
A
 
H
D
 
A
H
 
H
A
 
G
A
 
N
E
 
Q
S
 
G
N
 
-
M
 
-
E
 
-
V
 
-
P
 
-
K
 
-
E
 
-
P
 
-
I
 
-
I
 
F
F
|
F
N
 
L
K
 
K
W
 
P
T
 
G
S
 
S
A
 
A
I
 
L
C
 
S
G
 
G
P
 
P
N
 
T
D
 
D
D
 
P
I
 
V
Q
 
V
I
 
L
P
 
P
R
 
A
-
 
V
G
 
P
S
 
G
L
 
R
K
 
E
T
 
V
D
 
H
W
 
H
E
|
E
V
 
S
E
|
E
L
 
L
G
 
A
V
 
I
V
 
I
I
 
I
G
 
G
K
 
K
G
 
T
G
 
C
R
 
R
Y
 
S
I
 
V
D
 
A
E
 
R
A
 
E
N
 
D
A
 
W
M
 
K
E
 
D
H
 
V
V
 
V
A
 
F
G
 
G
Y
 
Y
C
 
A
V
 
C
I
 
L
N
 
L
D
|
D
V
 
M
S
 
V
E
 
V
R
 
R
E
 
G
W
 
R
Q
 
V
L
 
F
E
 
R
R
 
-
G
 
-
G
 
-
T
 
-
W
 
-
D
 
-
K
 
-
G
 
-
K
|
K
G
 
A
F
 
Y
D
 
D
T
 
T
F
 
F
G
 
C
P
 
P
L
 
V
G
 
G
P
 
P
W
 
W
L
 
I
V
 
T
T
 
T
R
 
A
D
 
D
E
 
A
I
 
V
A
 
N
D
 
D
P
 
P
H
 
A
T
 
T
L
 
L
D
 
D
L
 
M
W
 
K
L
 
L
E
 
W
V
 
V
D
 
N
G
 
D
H
 
D
R
 
L
Y
 
R
Q
 
Q
N
 
K
G
 
A
N
 
N
T
 
T
R
 
R
T
 
D
L
 
L
I
 
V
F
 
L
S
 
D
V
 
I
P
 
P
Q
 
G
L
 
M
I
 
I
A
 
A
Y
 
T
L
 
A
S
 
S
R
 
A
C
 
V
M
 
M
S
 
T
L
 
L
Q
 
Q
P
 
P
G
 
G
D
 
D
V
 
I
I
 
I
S
 
A
T
 
T
G
 
G
T
 
T
P
 
P
P
 
E
G
 
G
V
 
V
G
 
G
L
 
-
G
 
-
I
 
-
K
 
-
P
 
-
A
 
-
P
 
P
V
 
V
F
 
V
L
 
-
R
 
-
P
 
D
G
 
G
Q
 
D
T
 
R
I
 
I
R
 
R
L
 
I
G
 
V
I
 
I
E
 
D
G
 
Q
L
 
V
G
 
G
E
 
E
Q
 
M
R
 
A
Q
 
V
V
 
D
T
 
V
V
 
V
Q
 
Q

1nkqA Crystal structure of yeast ynq8, a fumarylacetoacetate hydrolase family protein
32% identity, 63% coverage: 72:248/282 of query aligns to 10:210/247 of 1nkqA

query
sites
1nkqA
K
 
K
F
 
I
I
 
I
C
 
C
I
 
I
G
 
G
L
 
R
N
 
N
Y
 
Y
A
 
A
D
 
A
H
 
H
A
 
I
A
 
K
E
 
E
S
 
L
N
 
N
M
 
-
E
 
-
V
 
-
P
 
-
K
 
N
E
 
Q
P
 
P
I
 
F
I
 
F
F
 
F
N
 
L
K
 
K
W
 
P
T
 
T
S
 
S
A
 
S
I
 
I
C
 
V
G
 
T
P
 
P
-
 
L
-
 
S
-
 
S
-
 
S
-
 
P
-
 
A
-
 
N
-
 
S
-
 
T
-
 
F
-
 
N
-
 
G
-
 
L
N
 
N
D
 
E
D
 
D
-
 
G
-
 
T
-
 
N
-
 
P
-
 
G
-
 
P
I
 
I
Q
 
F
I
 
I
P
 
P
R
 
R
G
 
G
S
 
-
L
 
V
K
 
K
T
 
V
D
 
H
W
 
H
E
|
E
V
 
I
E
|
E
L
 
L
G
 
A
V
 
L
V
 
I
I
 
V
G
 
S
K
 
K
G
 
H
G
 
L
R
 
S
Y
 
N
I
 
V
D
 
T
E
 
K
A
 
M
N
 
K
A
 
P
M
 
E
E
 
E
-
 
V
-
 
Y
-
 
D
H
 
S
V
 
I
A
 
S
G
 
G
Y
 
V
C
 
A
V
 
L
I
 
A
N
 
L
D
|
D
V
 
L
S
 
T
E
 
A
R
 
R
E
 
N
W
 
V
Q
 
Q
L
 
D
E
 
E
-
 
A
-
 
K
-
 
K
R
 
K
G
 
G
G
 
L
T
 
P
W
 
W
D
 
T
K
 
I
G
 
S
K
 
K
G
 
G
F
 
F
D
 
D
T
 
T
F
 
F
G
 
M
P
 
P
L
 
I
G
 
S
P
 
-
W
 
A
L
 
I
V
 
V
T
 
S
R
 
R
D
 
E
E
 
K
I
 
F
A
 
S
D
 
S
P
 
Y
H
 
K
T
 
S
-
 
N
-
 
L
-
 
Q
-
 
D
-
 
I
L
 
F
D
 
R
L
 
V
W
 
K
L
 
C
E
 
S
V
 
V
D
 
N
G
 
G
H
 
Q
R
 
L
Y
 
R
Q
 
Q
N
 
D
G
 
G
N
 
G
T
 
T
R
 
N
T
 
L
L
 
M
I
 
L
F
 
H
S
 
P
V
 
L
P
 
H
Q
 
K
L
 
I
I
 
L
A
 
Q
Y
 
H
L
 
I
S
 
S
R
 
T
C
 
M
M
 
I
S
 
S
L
 
L
Q
 
E
P
 
P
G
 
G
D
 
D
V
 
I
I
 
I
S
 
L
T
 
T
G
 
G
T
 
T
P
 
P
P
 
A
G
 
G
V
 
V
G
 
G

Q97UA0 2-dehydro-3-deoxy-D-arabinonate dehydratase; 2-keto-3-deoxy-D-arabinonate dehydratase; KdaD; EC 4.2.1.141 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
29% identity, 65% coverage: 95:278/282 of query aligns to 118:298/298 of Q97UA0

query
sites
Q97UA0
P
 
P
I
 
E
I
 
I
F
 
F
N
 
F
K
 
K
W
 
A
T
 
T
S
 
P
A
 
N
I
 
R
C
 
C
-
 
V
G
 
G
P
 
H
N
 
G
D
 
E
D
 
A
I
 
I
Q
 
A
I
 
V
P
 
R
R
 
S
G
 
D
S
 
S
L
 
E
K
 
W
T
 
T
D
 
L
W
 
P
E
|
E
V
 
P
E
|
E
L
 
L
G
 
A
V
 
V
V
 
V
I
 
L
G
 
D
K
 
S
G
 
N
G
 
G
R
 
K
Y
 
-
I
 
-
D
 
-
E
 
-
A
 
-
N
 
-
A
 
-
M
 
-
E
 
-
H
 
-
V
 
I
A
 
L
G
 
G
Y
 
Y
C
 
T
V
 
I
I
 
M
N
 
D
D
|
D
V
 
V
S
 
S
E
 
A
R
 
R
E
 
D
W
 
L
Q
 
E
L
 
A
E
 
E
R
 
N
G
 
P
G
 
L
T
 
Y
W
 
L
D
 
P
K
 
Q
G
 
S
K
|
K
G
 
I
F
 
Y
D
 
A
T
 
G
F
 
C
G
 
C
P
 
A
L
 
F
G
 
G
P
 
P
W
 
V
L
 
I
V
 
V
T
 
T
R
 
S
D
 
D
E
 
E
I
 
I
A
 
K
D
 
N
P
 
P
H
 
Y
T
 
S
L
 
L
D
 
D
L
 
I
W
 
T
L
 
L
E
 
K
V
 
I
-
 
V
-
 
R
D
 
E
G
 
G
H
 
R
R
 
V
Y
 
F
Q
 
F
N
 
E
G
 
G
-
 
S
-
 
V
N
 
N
T
 
T
R
 
N
T
 
K
L
 
M
I
 
R
F
 
R
S
 
K
V
 
I
P
 
E
Q
 
E
L
 
Q
I
 
I
A
 
Q
Y
 
Y
L
 
L
S
 
I
R
 
R
C
 
D
M
 
N
S
 
P
L
 
I
Q
 
P
P
 
D
G
 
G
D
 
T
V
 
I
I
 
L
S
 
T
T
 
T
G
 
G
T
|
T
P
 
A
-
 
I
-
 
V
P
 
P
G
 
G
V
 
R
G
 
D
L
 
K
G
 
G
I
 
L
K
 
K
P
 
D
A
 
E
P
 
D
V
 
I
F
 
V
L
 
E
R
 
I
P
 
T
G
 
I
Q
 
S
T
 
N
I
 
I
R
 
G
L
 
T
G
 
L
I
 
I
E
 
T
G
 
P
L
 
V
G
 
K
E
 
K
Q
 
R
R
 
R
Q
 
K
V
 
I
T
 
T

Sites not aligning to the query:

Query Sequence

>AO356_28735 FitnessBrowser__pseudo5_N2C3_1:AO356_28735
MKLLRYGEKGSEKPGLLDTDNQLRDLSGRVPDIAGQVLGADSLAALAALDPRSLPLVAGQ
PRIGACVGQVGKFICIGLNYADHAAESNMEVPKEPIIFNKWTSAICGPNDDIQIPRGSLK
TDWEVELGVVIGKGGRYIDEANAMEHVAGYCVINDVSEREWQLERGGTWDKGKGFDTFGP
LGPWLVTRDEIADPHTLDLWLEVDGHRYQNGNTRTLIFSVPQLIAYLSRCMSLQPGDVIS
TGTPPGVGLGIKPAPVFLRPGQTIRLGIEGLGEQRQVTVQAD

Or try a new SitesBLAST search

SitesBLAST's Database

SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory