SitesBLAST
Comparing AO356_28845 FitnessBrowser__pseudo5_N2C3_1:AO356_28845 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P07821 Iron(3+)-hydroxamate import ATP-binding protein FhuC; Ferric hydroxamate uptake protein C; Ferrichrome transport ATP-binding protein FhuC; Iron(III)-hydroxamate import ATP-binding protein FhuC; EC 7.2.2.16 from Escherichia coli (strain K12) (see 2 papers)
31% identity, 92% coverage: 2:231/251 of query aligns to 10:247/265 of P07821
- K50 (= K43) mutation to Q: Lack of activity.
- D172 (= D156) mutation to E: Lack of activity.
- E173 (= E157) mutation to A: Lack of activity.
1vciA Crystal structure of the atp-binding cassette of multisugar transporter from pyrococcus horikoshii ot3 complexed with atp (see paper)
32% identity, 82% coverage: 1:205/251 of query aligns to 4:202/353 of 1vciA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
32% identity, 86% coverage: 4:220/251 of query aligns to 2:224/240 of 4ymuJ
- binding adenosine-5'-triphosphate: F11 (≠ Y13), V16 (= V18), S36 (≠ N39), G37 (≠ A40), S38 (≠ A41), G39 (= G42), K40 (= K43), S41 (= S44), T42 (= T45), E162 (= E157), H194 (= H190)
- binding magnesium ion: S41 (= S44), E162 (= E157)
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
33% identity, 87% coverage: 4:221/251 of query aligns to 3:225/241 of 4u00A
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
28% identity, 87% coverage: 1:219/251 of query aligns to 4:230/375 of 2d62A
4zirB Crystal structure of ecfaa' heterodimer bound to amppnp (see paper)
31% identity, 86% coverage: 4:220/251 of query aligns to 4:216/247 of 4zirB
- binding phosphoaminophosphonic acid-adenylate ester: Y13 (= Y13), V18 (= V18), N38 (= N39), G39 (≠ A40), G41 (= G42), K42 (= K43), T43 (≠ S44), T44 (= T45), Q80 (= Q77), N129 (≠ E131), S131 (= S133), G132 (= G134), G133 (= G135)
- binding magnesium ion: T43 (≠ S44), Q80 (= Q77)
4hluC Structure of the ecfa-a' heterodimer bound to adp (see paper)
31% identity, 86% coverage: 4:220/251 of query aligns to 5:220/249 of 4hluC
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
30% identity, 77% coverage: 29:222/251 of query aligns to 42:238/378 of P69874
- F45 (≠ V32) mutation to L: Lower ATPase activity and transport efficiency.
- C54 (≠ A41) mutation to T: Loss of ATPase activity and transport.
- L60 (≠ F47) mutation to F: Lower ATPase activity and transport efficiency.
- L76 (= L62) mutation to P: Lower ATPase activity and transport efficiency.
- V135 (≠ L119) mutation to M: Loss of ATPase activity and transport.
- D172 (= D156) mutation to N: Loss of ATPase activity and transport.
Sites not aligning to the query:
- 26 C→A: Lower ATPase activity and transport efficiency.
- 27 F→L: Lower ATPase activity and transport efficiency.
- 276 C→A: Lower ATPase activity and transport efficiency.
- 297 mutation E->K,D: Lower ATPase activity and transport efficiency.; E→Q: Loss of ATPase activity and transport.
3bk7A Structure of the complete abce1/rnaase-l inhibitor protein from pyrococcus abysii (see paper)
33% identity, 70% coverage: 30:205/251 of query aligns to 368:531/593 of 3bk7A
Sites not aligning to the query:
- binding adenosine-5'-diphosphate: 87, 92, 112, 113, 114, 115, 116, 117, 118, 292, 353
- binding iron/sulfur cluster: 15, 16, 20, 25, 29, 30, 38, 39, 55, 56, 57, 58, 59, 61, 65, 70
1yqtA Rnase-l inhibitor (see paper)
34% identity, 70% coverage: 30:205/251 of query aligns to 289:452/515 of 1yqtA
Sites not aligning to the query:
- binding adenosine-5'-diphosphate: 8, 13, 33, 34, 36, 37, 38, 39, 274, 277
- binding magnesium ion: 38, 90
5yv5A Crystal structure of the complex of archaeal ribosomal stalk protein ap1 and archaeal ribosome recycling factor aabce1. (see paper)
34% identity, 70% coverage: 30:205/251 of query aligns to 292:455/517 of 5yv5A
Sites not aligning to the query:
- binding adenosine-5'-diphosphate: 11, 14, 16, 36, 37, 39, 40, 41, 42, 277, 280
- binding magnesium ion: 41, 93
- binding : 94, 97, 98, 100, 101, 151, 152, 155
1l7vC Bacterial abc transporter involved in b12 uptake (see paper)
30% identity, 80% coverage: 30:229/251 of query aligns to 25:229/231 of 1l7vC
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
26% identity, 90% coverage: 4:229/251 of query aligns to 3:233/240 of 6mjpA
4fi3C Structure of vitamin b12 transporter btucd-f in a nucleotide-bound state (see paper)
29% identity, 82% coverage: 30:234/251 of query aligns to 25:234/248 of 4fi3C
- binding phosphoaminophosphonic acid-adenylate ester: N34 (= N39), G35 (≠ A40), G37 (= G42), K38 (= K43), S39 (= S44), T40 (= T45), R121 (= R127), Q125 (≠ E131), S127 (= S133), G129 (= G135), E130 (≠ Q136), Q158 (≠ E157)
- binding magnesium ion: S39 (= S44), Q79 (≠ A94)
Sites not aligning to the query:
7w78A Heme exporter hrtba in complex with mg-amppnp (see paper)
33% identity, 72% coverage: 30:210/251 of query aligns to 34:215/218 of 7w78A
Sites not aligning to the query:
7w79A Heme exporter hrtba in complex with mn-amppnp (see paper)
33% identity, 72% coverage: 30:210/251 of query aligns to 34:215/216 of 7w79A
Sites not aligning to the query:
P45844 ATP-binding cassette sub-family G member 1; ATP-binding cassette transporter 8; White protein homolog; EC 7.6.2.- from Homo sapiens (Human) (see 6 papers)
32% identity, 77% coverage: 14:206/251 of query aligns to 96:291/678 of P45844
- K124 (= K43) mutation to M: Affects ATP binding. Does not affect efflux of 7beta-hydroxycholesterol. Does not affect localization at plasma membrane. Does not affect homodimerization. Decreases cholesterol and phospholipids efflux. Does not affect heretodimerization with ABCG4.
- C154 (≠ A81) modified: S-palmitoyl cysteine; mutation to A: No significant effect.
Sites not aligning to the query:
- 30 modified: S-palmitoyl cysteine; C→A: No significant effect.
- 315 modified: S-palmitoyl cysteine; mutation C->A,S: Significantly decreases ABCG1-mediated cholesterol efflux.
- 394 modified: S-palmitoyl cysteine; C→A: No significant effect.
- 406 modified: S-palmitoyl cysteine; C→A: No significant effect.
- 491 Y→A: Significantly reduces interaction with CAV1; when associated with A-493. Significantly reduces ABCG1-mediated cholesterol efflux; when associated with A-493.
- 493 Y→A: Significantly reduces interaction with CAV1; when associated with A-491. Significantly reduces ABCG1-mediated cholesterol efflux; when associated with A-491.
- 498 Y→A: Significantly reduces interaction with CAV1; when associated with A-499. Significantly reduces ABCG1-mediated cholesterol efflux; when associated with A-499. Affects subcellular location at plasma membrane; when associated with A-499. Affects ABCG1 traffincking to the plasma membrane; when associated with A-499.; Y→F: Does not affect ABCG1-mediated cholesterol efflux; when associated with I-499.; Y→I: Dramatically reduces the ability of ABCG1 to mediate cholesterol efflux; when associated with I-499.; Y→W: Does not affect ABCG1-mediated cholesterol efflux; when associated with I-499.
- 499 Y→A: Significantly reduces interaction with CAV1; when associated with A-498. Significantly reduces ABCG1-mediated cholesterol efflux; when associated with A-498. Affects subcellular location at plasma membrane; when associated with A-498. Affects ABCG1 traffincking to the plasma membrane; when associated with A-498.; Y→F: Does not affect ABCG1-mediated cholesterol efflux; when associated with I-498.; Y→I: Dramatically reduces the ability of ABCG1 to mediate cholesterol efflux; when associated with I-498.; Y→W: Does not affect ABCG1-mediated cholesterol efflux; when associated with I-498.
- 668 natural variant: F -> L
7r8eA The structure of human abcg1 e242q complexed with atp (see paper)
31% identity, 82% coverage: 2:206/251 of query aligns to 4:211/548 of 7r8eA
Sites not aligning to the query:
4yerA Crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution
26% identity, 94% coverage: 4:240/251 of query aligns to 5:243/285 of 4yerA
- binding adenosine-5'-diphosphate: F14 (≠ Y13), F17 (≠ R16), N39 (= N39), G40 (≠ A40), G42 (= G42), K43 (= K43), T44 (≠ S44), T45 (= T45), T135 (≠ E131), F136 (≠ L132), S137 (= S133)
7oz1A Cryo-em structure of abcg1 e242q mutant with atp and cholesteryl hemisuccinate bound (see paper)
32% identity, 77% coverage: 14:206/251 of query aligns to 16:211/544 of 7oz1A
Sites not aligning to the query:
- binding adenosine-5'-triphosphate: 15
- binding cholesterol hemisuccinate: 335, 335, 367, 431, 431, 434, 435, 438, 438, 439, 441, 463, 466, 466, 467, 525, 526, 527, 529, 530, 531, 532, 533, 535
Query Sequence
>AO356_28845 FitnessBrowser__pseudo5_N2C3_1:AO356_28845
MVTIRLENLGARYGQRTVIHGVTTAAFVGGQVVAVVGPNAAGKSTLFKRMAGLIDGPGQV
ILEGSKKGPQGISYMPQGLNASARLTVYESVLLARKQLTPGWVVHDDELKRVDDILAALG
ITELSFRNLGELSGGQQQLVSIAQTLVREPEILLMDEPTSALDMHRQVQVLNFMRALARK
RQVIVFIAIHDLNQALRFADQVLVIADNTAQGSGPSAEVITESMLRQVYKVEARIEQCSR
GERHILIDDIV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory