Comparing AO356_29105 FitnessBrowser__pseudo5_N2C3_1:AO356_29105 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 7 hits to proteins with known functional sites (download)
3lzkC The crystal structure of a probably aromatic amino acid degradation protein from sinorhizobium meliloti 1021
50% identity, 98% coverage: 1:322/330 of query aligns to 7:338/343 of 3lzkC
8gstC Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Pyruvate bound-form) (see paper)
28% identity, 61% coverage: 111:312/330 of query aligns to 95:274/290 of 8gstC
Sites not aligning to the query:
8gsrA Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Apo-form) (see paper)
28% identity, 61% coverage: 111:312/330 of query aligns to 95:274/290 of 8gsrA
8skyB Crystal structure of yisk from bacillus subtilis in complex with oxalate (see paper)
24% identity, 60% coverage: 110:306/330 of query aligns to 124:290/303 of 8skyB
Sites not aligning to the query:
8sutA Crystal structure of yisk from bacillus subtilis in complex with reaction product 4-hydroxy-2-oxoglutaric acid (see paper)
24% identity, 60% coverage: 110:306/330 of query aligns to 125:291/303 of 8sutA
Sites not aligning to the query:
3r6oA Crystal structure of a probable 2-hydroxyhepta-2,4-diene-1, 7- dioateisomerase from mycobacterium abscessus (see paper)
25% identity, 47% coverage: 109:264/330 of query aligns to 75:226/265 of 3r6oA
3qdfA Crystal structure of 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase from mycobacterium marinum (see paper)
26% identity, 48% coverage: 111:270/330 of query aligns to 76:226/252 of 3qdfA
>AO356_29105 FitnessBrowser__pseudo5_N2C3_1:AO356_29105
MKLSTLKHPSRDGRLLVVSRDLAWAVEASDIAATLQDAIERWPSVEAALRLRYDALNEGM
LTGAFPFDPQQAAAPLPRAWQWLDASSFLSHGERMQKAFALDPIEGVEHTPLMYQGCGDD
FLGAHDDIVLPSESHGIDFEGEFAVLVDEVPMGCSAQDAVDHVRLIVQVNDVSLRALAPR
EMKTGFGFIQAKSSSSFAPVAITPDELGEAWRDGRVHLPLRVEWNGQWFGHAHGGAMHFG
FHQLIAHAAMTRRLRAGCVIGSGTVSNADPTVGAACIAERRAVEMIEQGAPQTPFMRFGD
RVRMEVFDLQGQSVFGAIDQCVVRGGLPCA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory