SitesBLAST
Comparing AO356_29600 FitnessBrowser__pseudo5_N2C3_1:AO356_29600 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 18 hits to proteins with known functional sites (download)
Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
26% identity, 54% coverage: 26:257/432 of query aligns to 56:272/444 of Q8NLB7
- D57 (= D27) mutation to A: Loss of transport activity.; mutation to E: Retains 50% of its transport activity.
- R103 (≠ V79) mutation to A: Loss of transport activity.
Sites not aligning to the query:
- 54 D→A: Loss of transport activity.; D→E: Retains 50% of its transport activity.
- 309 W→V: Loss of transport activity.
- 312 D→A: Loss of transport activity.
- 313 R→A: Loss of transport activity.
- 317 mutation I->H,Y: Loss of transport activity.
- 386 R→A: Loss of transport activity.
P77589 3-(3-hydroxy-phenyl)propionate transporter; 3HPP transporter; 3-(3-hydroxy-phenyl)propionate:H(+) symporter; 3HPP:H(+) symporter from Escherichia coli (strain K12) (see paper)
30% identity, 40% coverage: 58:231/432 of query aligns to 55:212/403 of P77589
- D75 (= D78) mutation D->A,E: Lack of 3HPP transport activity.
Sites not aligning to the query:
- 27 E→A: Lack of 3HPP transport activity.; E→D: Slight decrease in 3HPP transport activity.
- 272 A→H: 30% increase in 3HPP transport activity.
- 276 K→D: Lack of 3HPP transport activity.
O08966 Solute carrier family 22 member 1; Organic cation transporter 1; mOCT1 from Mus musculus (Mouse) (see paper)
24% identity, 37% coverage: 68:228/432 of query aligns to 162:319/556 of O08966
Sites not aligning to the query:
- 32 L→F: Increased trospium uptake. Increased trospium affinity. No change in fenoterol uptake.
- 36 Y→C: Decreased fenoterol uptake. Decreased fenoterol affinity. No change in trospium uptake. No change in terbutaline affinity.
Q5EXK5 3-hydroxybenzoate transporter MhbT from Klebsiella oxytoca (see paper)
32% identity, 34% coverage: 74:222/432 of query aligns to 78:211/452 of Q5EXK5
- D82 (= D78) mutation to A: Loss of activity.
Sites not aligning to the query:
- 311 V→W: Loss of activity.
- 314 D→A: Loss of activity.
Q9Y7Q9 Probable metabolite transporter C2H8.02 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
25% identity, 38% coverage: 58:223/432 of query aligns to 88:260/583 of Q9Y7Q9
Sites not aligning to the query:
- 267 modified: Phosphoserine
- 269 modified: Phosphoserine
- 289 modified: Phosphoserine
- 290 modified: Phosphoserine
- 292 modified: Phosphoserine
- 330 modified: Phosphoserine
A0A0H2VG78 Glucose transporter GlcP; Glucose/H(+) symporter from Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) (see paper)
24% identity, 81% coverage: 74:423/432 of query aligns to 63:434/446 of A0A0H2VG78
- R102 (= R121) mutation to A: Loss of transport activity.
- I105 (≠ Q124) mutation to S: Affects symport activity. May function as an uniporter.
- E122 (= E141) mutation to A: Loss of transport activity.
- Q137 (≠ Y156) mutation to A: Loss of transport activity.
- Q250 (= Q264) mutation to A: Loss of transport activity.
- Q251 (vs. gap) mutation to A: Loss of transport activity.
- N256 (≠ D267) mutation to A: Loss of transport activity.
- W357 (= W338) mutation to A: Loss of transport activity.
Sites not aligning to the query:
- 22 D→N: Affects symport activity. May function as an uniporter.
P25297 Inorganic phosphate transporter PHO84 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
26% identity, 33% coverage: 68:211/432 of query aligns to 117:273/587 of P25297
Sites not aligning to the query:
- 6 modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
- 298 modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
8et9A Cryo-em structure of the organic cation transporter 2 in complex with 1-methyl-4-phenylpyridinium (see paper)
33% identity, 18% coverage: 70:148/432 of query aligns to 157:232/517 of 8et9A
Sites not aligning to the query:
Q63089 Solute carrier family 22 member 1; Organic cation transporter 1; rOCT1 from Rattus norvegicus (Rat) (see 4 papers)
26% identity, 25% coverage: 68:173/432 of query aligns to 162:259/556 of Q63089
- C179 (≠ I85) mutation to A: Choline affinity is increased fourfold by MMTS; when associated with A-26; A-155; S-322; A-358; A-418; S-437; A-470 and A-474.
- M212 (≠ L126) mutation to L: No change in TEA and MPP(+) uptake.
- V213 (≠ A127) mutation to G: Decreased TEA uptake. No change in MPP(+) uptake.
- S214 (≠ H128) mutation to G: Decreased TEA and MPP(+) uptake.
- K215 (≠ G129) mutation to Q: Loss of TEA and MPP(+) uptake activity.; mutation to R: Loss of TEA and MPP(+) uptake activity.
- G216 (= G130) mutation to A: Decreased TEA and MPP(+) uptake.
- S217 (≠ E131) mutation to G: No change in TEA and MPP(+) uptake.
- W218 (≠ T132) mutation to F: Decreased guanidine, histamine, serotonin and TEA uptake. No change in MPP(+) uptake. No change in TEA and MPP(+) affinity. Decreased TEA Vmax. No change in MPP(+) Vmax.; mutation to L: Decreased guanidine, histamine, serotonin, TEA and MPP(+) uptake. Decreased TEA affinity. No change in MPP(+) affinity. Decreased TEA and MPP(+) Vmax.; mutation to Y: Decreased guanidine, histamine, serotonin and TEA uptake. No change in MPP(+) uptake. Increased TEA and MPP(+) affinity. Decreased TEA and MPP(+) Vmax.
- V219 (≠ G133) mutation to L: No change in TEA and MPP(+) uptake.
- S220 (≠ V134) mutation to I: Decreased TEA and MPP(+) uptake.
- G221 (≠ S135) mutation to A: Decreased TEA and MPP(+) uptake.
- Y222 (= Y136) mutation to F: No change in guanidine, histamine, serotonin, TEA and MPP(+) uptake. Increased TEA affinity. No change in MPP(+) affinity. Decreased TEA Vmax. No change in MPP(+) Vmax.; mutation to L: Decreased guanidine, serotonin, TEA and MPP(+) uptake. No change in histamine uptake. Increased TEA and MPP(+) affinity. Decreased TEA and MPP(+) Vmax.
- T223 (= T137) mutation to I: Decreased TEA uptake. No change in MPP(+) uptake.
- L224 (≠ Y138) mutation to V: Decreased TEA and MPP(+) uptake.
- I225 (≠ V139) mutation to G: No change in TEA and MPP(+) uptake.
- T226 (≠ A140) mutation to A: Decreased TEA uptake. No change in MPP(+) uptake.
- E227 (= E141) mutation to D: Loss of TEA and MPP(+) uptake activity.; mutation to Q: Loss of TEA and MPP(+) uptake activity.
- F228 (≠ I142) mutation to I: No change in TEA and MPP(+) uptake.
- V229 (≠ A143) mutation to A: Decreased TEA and MPP(+) uptake.; mutation to L: Loss of TEA and MPP(+) uptake activity.
Sites not aligning to the query:
- 26 C→A: Choline affinity is increased fourfold by MMTS; when associated with A-155; A-179; S-322; A-358; A-418; S-437; A-470 and A-474.
- 155 C→A: Choline affinity is increased fourfold by MMTS; when associated with A-26; A-179; S-322; A-358; A-418; S-437; A-470 and A-474.
- 286 S→A: No effect of PKC-induced stimulation on ASP uptake. No effect of PKC-induced stimulation on ASP uptake; when associated with A-292; A-296; A-328 and A-550. No effect of PKA activation on ASP uptake. No effect of PKA activation on ASP uptake; when associated with A-292; A-296; A-328 and A-550. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition; when associated with A-292; A-296; A-328 and A-550. No significant effect on trafficking from intracellular pools to the cell membrane; when associated with A-292; A-296; A-328 and A-550. suppresses phosphorylation by PKC; when associated with A-292; A-296; A-328 and A-550.
- 292 S→A: No effect of PKC-induced stimulation on ASP uptake. No effect of PKC-induced stimulation on ASP uptake; when associated with A-286; A-296; A-328 and A-550. No effect of PKA activation on ASP uptake. No effect of PKA activation on ASP uptake; when associated with A-286; A-296; A-328 and A-550. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition; when associated with A-286; A-296; A-328 and A-550. No significant effect on trafficking from intracellular pools to the cell membrane; when associated with A-286; A-296; A-328 and A-550. suppresses phosphorylation by PKC; when associated with A-286; A-296; A-328 and A-550.
- 296 T→A: No effect of PKC-induced stimulation on ASP uptake. No effect of PKC-induced stimulation on ASP uptake; when associated with A-286; A-292; A-328; A-550. Significant increase of the ASP uptake by PKA activation. No effect of PKA activation on ASP uptake; when associated with A-286; A-292; A-328; A-550. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition; when associated with A-286; A-292; A-328; A-550. No significant effect on trafficking from intracellular pools to the cell membrane; when associated with A-286; A-292; A-328 and A-550. suppresses phosphorylation by PKC; when associated with A-286; A-292; A-328 and A-550.
- 322 C→S: Reduces the activation by MMTS. Abolishes the activation by MMTs; when associated with M-451. Choline affinity is increased fivefold by MMTS. Choline affinity is increased fourfold by MMTS; when associated with A-26; A-155; A-179; A-358; A-418; S-437; A-470 and A-474. Choline affinity is increased four- to fivefold; when associated with M-451.
- 328 S→A: No effect of PKC-induced stimulation on ASP uptake. No effect of PKC-induced stimulation on ASP uptake; when associated with A-286; A-292; A-296 and A-550. No effect of PKA activation on ASP uptake. No effect of PKA activation on ASP uptake; when associated with A-286; A-292; A-296 and A-550. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition; when associated with A-286; A-292; A-296; A-550. No significant effect on trafficking from intracellular pools to the cell membrane; when associated with A-286; A-292; A-296 and A-550. suppresses phosphorylation by PKC; when associated with A-286; A-292; A-296 and A-550.
- 358 C→A: Choline affinity is increased fourfold by MMTS; when associated with A-26; A-155; A-179; S-322; A-418; S-437; A-470 and A-474.
- 418 C→A: Choline affinity is increased fourfold by MMTS; when associated with A-26; A-155; A-179; S-322; A-358; S-437; A-470 and A-474.
- 437 C→S: Choline affinity is increased fourfold by MMTS; when associated with A-26; A-155; A-179; S-322; A-358; A-418; A-470 and A-474.
- 451 C→M: Reduces the activation by MMTS. Abolishes the activation by MMTs; when associated with S-322. Abolishes the effect of MMTs on choline-induced currents. Choline affinity is not influenced by MMTS. Choline affinity is increased four- to fivefold; when associated with S-322.
- 470 C→A: Choline affinity is increased fourfold by MMTS; when associated with A-26; A-155; A-179; S-322; A-358; A-418; A-437 and A-474.
- 474 C→A: Choline affinity is increased fourfold by MMTS; when associated with A-26; A-155; A-179; S-322; A-358; A-418; A-437 and A-470.
- 475 D→E: Decreased MPP(+) uptake, no change in MPP(+) affinity. Decreased NMN uptake, increased NMN affinity. Decreased choline uptake, increased choline affinity.; D→N: Decreased MPP(+) uptake.; D→R: Decreased MPP(+) uptake.
- 550 T→A: No effect of PKC-induced stimulation on ASP uptake. No effect of PKC-induced stimulation on ASP uptake; when associated with A-286; A-292; A-296; A-328. Significant increase of the ASP uptake by PKA activation. No effect of PKA activation on ASP uptake; when associated with A-286; A-292; A-296 and A-328. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition; when associated with A-286; A-292; A-296; A-328. No significant effect on trafficking from intracellular pools to the cell membrane; when associated with A-286; A-292; A-296 and A-328. suppresses phosphorylation by PKC; when associated with A-286; A-292; A-296 and A-328.
O15245 Solute carrier family 22 member 1; Organic cation transporter 1; hOCT1 from Homo sapiens (Human) (see 10 papers)
30% identity, 24% coverage: 70:173/432 of query aligns to 158:258/554 of O15245
- L160 (≠ F72) to F: no changes in both MPP(+) and TEA uptake; abolishes MPP(+) uptake when associated with S-401; largely localized to the plasma membrane; dbSNP:rs683369
- S189 (= S96) to L: no changes in MPP(+) uptake; dbSNP:rs34104736
- G220 (≠ S135) to V: affects transporter activity; reduction of MPP(+) uptake when associated with V-408; dbSNP:rs36103319
- Y240 (≠ V155) mutation to F: Decreased TEA uptake.
Sites not aligning to the query:
- 14 S → F: exclusively found in the African American population; increased MPP(+) uptake when associated with V-408; dbSNP:rs34447885
- 24 I→L: No change in fenoterol uptake. No change in trospium uptake. No change in terbutaline uptake.
- 28 L→I: No change in fenoterol uptake. No change in trospium uptake. No change in terbutaline uptake.
- 31 A→S: No change in fenoterol uptake. No change in trospium uptake. No change in terbutaline uptake.
- 32 F→L: No change in fenoterol uptake. Decreased trospium uptake. Decreased trospium affinity.
- 36 C→Y: Increased fenoterol uptake. Increased fenoterol affinity. No change in trospium uptake. No change in terbutaline uptake. No change in terbutaline affinity.
- 41 F → L: in dbSNP:rs2297373
- 61 R → C: affects transporter activity; reduction of MPP(+) uptake; reduction of serum O-isobutanoyl-(R)-carnitine levels; reduction of MPP(+) uptake when associated with V-408; dbSNP:rs12208357
- 85 L → F: no changes in MPP(+) uptake; when associated with V-408; dbSNP:rs35546288
- 88 C → R: affects transporter activity; reduction of MPP(+), serotonin and TEA uptake; dbSNP:rs55918055
- 283 P → L: in dbSNP:rs4646277; P→A: Decreased TEA uptake.
- 287 R → G: in dbSNP:rs4646278
- 341 P → L: affects transporter activity; reduction of TEA uptake; reduction o MPP(+) uptake when associated with V-408; largely localized to the plasma membrane; dbSNP:rs2282143
- 342 R → H: no changes in MPP(+) uptake when associated with V-408; dbSNP:rs34205214
- 361 Y→F: Decreased TEA uptake.
- 376 Y→F: Decreased TEA uptake.
- 401 G → S: affects transporter activity; reduction of MPP(+), serotonin and TEA uptake; no MPP(+) uptake when associated with L-160; dbSNP:rs34130495
- 408 M → V: does not affect transporter activity; no changes in MPP(+) uptake when associated with F-14; no changes in MPP(+) uptake when associated with F-85; no changes in MPP(+) uptake when associated with L-189; no changes in MPP(+) uptake when associated with H-342; no changes in MPP(+) uptake when associated with M-420 del; no changes in MPP(+) uptake when associated with I-440; no changes in MPP(+) uptake when associated with I-461; no changes in MPP(+) uptake when associated with M-488; reduction of MPP uptake when associated with C-61; no MPP(+) uptake when associated with V-220; reduction of MPP(+) uptake when associated with L-341; no MPP(+) uptake when associated with S-401; no MPP(+) uptake when associated with R-465; dbSNP:rs628031
- 420 natural variant: Missing (reduction of serum O-isobutanoyl-(R)-carnitine levels; no change in MPP(+) uptake; no changes in MPP(+) uptake when associated with V-408; dbSNP:rs72552763)
- 440 M → I: in dbSNP:rs35956182
- 461 V → I: no changes in MPP(+) uptake when associated with V-408; dbSNP:rs34295611
- 465 G → R: reduction of the localization to the basolateral membrane; no MPP(+) uptake when associated with V-408; dbSNP:rs34059508; G→A: No changes in MPP(+) uptake.
- 488 R → M: no changes in MPP(+) uptake when associated with V-408; dbSNP:rs35270274
Q51330 Oxalate:formate antiporter; OFA; Oxalate:formate antiport protein; Oxalate:formate exchange protein from Oxalobacter formigenes (see 4 papers)
26% identity, 41% coverage: 201:375/432 of query aligns to 189:363/418 of Q51330
- C271 (≠ I281) mutation to A: Slight decrease in activity; when associated with G-28.
- G349 (= G363) mutation to C: Loss of activity.
- K355 (≠ S367) mutation K->C,G,Q,T: Loss of activity.; mutation to R: Residual activity.
- G362 (= G374) mutation to C: Residual activity.
- G363 (= G375) mutation to C: Residual activity.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 28 C→G: Slight decrease in activity; when associated with A-271.
- 56 Q→C: Residual activity.
- 59 F→C: Loss of activity.
- 66 Q→C: Residual activity.
- 69 S→C: Residual activity.
8sc2A Human oct1 bound to diltiazem in inward-open conformation (see paper)
30% identity, 24% coverage: 70:173/432 of query aligns to 140:240/453 of 8sc2A
Sites not aligning to the query:
8sc6A Human oct1 bound to thiamine in inward-open conformation (see paper)
30% identity, 24% coverage: 70:173/432 of query aligns to 140:240/447 of 8sc6A
Sites not aligning to the query:
8sc3A Human oct1 bound to fenoterol in inward-open conformation (see paper)
30% identity, 24% coverage: 70:173/432 of query aligns to 140:240/445 of 8sc3A
Sites not aligning to the query:
Q8MJI6 Solute carrier family 22 member 2; Organic cation transporter 2 from Oryctolagus cuniculus (Rabbit) (see paper)
30% identity, 24% coverage: 70:173/432 of query aligns to 158:258/554 of Q8MJI6
Sites not aligning to the query:
- 71 N→Q: Higher affinity for TEA. Loss of plasma membrane localization; when associated with Q-76. Loss of plasma membrane localization; when associated with Q-112. Loss of plasma membrane localization; when associated with Q-76 and Q-112.
- 96 N→Q: Higher affinity for TEA and lower Vmax.
- 112 N→Q: Higher affinity for TEA, lower Vmax and loss of plasma membrane localization.
Q51955 4-hydroxybenzoate transporter PcaK from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 2 papers)
27% identity, 32% coverage: 58:195/432 of query aligns to 69:190/448 of Q51955
- G85 (= G74) mutation to V: Abolishes 4-HBA transport and chemotaxis.
- D89 (= D78) mutation to N: Abolishes 4-HBA transport and chemotaxis.
- G92 (= G81) mutation to A: Decrease in 4-HBA transport and chemotaxis.; mutation to C: No change in 4-HBA transport and chemotaxis.; mutation G->L,V: Abolishes 4-HBA transport and chemotaxis.; mutation to Q: Decrease in 4-HBA transport and strong decrease in chemotaxis.
- R124 (= R121) mutation to A: Abolishes 4-HBA transport.
- E144 (= E141) mutation to A: Strong decrease in 4-HBA transport.
- H183 (≠ R188) mutation to A: Decrease in 4-HBA transport and chemotaxis.
Sites not aligning to the query:
- 41 mutation D->A,N: Abolishes 4-HBA transport.; D→E: Decrease in 4-HBA transport.
- 44 mutation D->A,N: Abolishes 4-HBA transport.; D→E: Decrease in 4-HBA transport.
- 323 D→N: Abolishes 4-HBA transport and chemotaxis.
- 328 H→A: Decrease in 4-HBA transport and chemotaxis.; H→R: Decrease in 4-HBA transport and loss of chemotaxis.
- 386 R→A: Strong decrease in 4-HBA transport.
- 398 R→A: Abolishes 4-HBA transport.
- 444 H→A: No change in 4-HBA transport and chemotaxis.
8hpkA Crystal structure of the bacterial oxalate transporter oxlt in an oxalate-bound occluded form (see paper)
27% identity, 37% coverage: 218:375/432 of query aligns to 187:348/390 of 8hpkA
Sites not aligning to the query:
7spsA Crystal structure of human glucose transporter glut3 bound with exofacial inhibitor sa47 (see paper)
26% identity, 33% coverage: 37:180/432 of query aligns to 38:178/468 of 7spsA
Sites not aligning to the query:
- binding methyl N-[(2-{4-[4-(5-fluoro-2-methoxyphenyl)piperazin-1-yl]-1H-pyrazolo[3,4-d]pyrimidin-1-yl}phenyl)methyl]-beta-alaninate: 21, 25, 29, 278, 286, 308, 312, 374, 375, 406, 407, 410
Query Sequence
>AO356_29600 FitnessBrowser__pseudo5_N2C3_1:AO356_29600
MNNSTSHQGRLRSLRAAAVGNALEWFDWTLYATFSVYLARNLFDKTDPRSAMLATLAVFA
AGFIARPLGGFFFGRLSDVLGRRAIMVITMMLLAASSLGIALIPNYQDIGLYASSALLVF
RLIQGLAHGGETGVSYTYVAEIAPAKHRGLWSSSVYVGVTLGVMGATAVAAALTWLLGTQ
ATGDYGWRIGFAIGGVLGIYALFLRRSAQESHVFEQQRQQAQPPRKLSKGEVLRMTRNIV
MLAAAANVTYYAWVTFGAASAIAQGMDATGAYLASLLAQVICVCWLPVCGMLSDRVGRKP
MVIAWGIGVVVLTYPISIIVTTEPYTLFLAQALALLAWASIAAIFPAVLSEQVPTQARAQ
SVGFVSSVSVAIFGGTAPYLHSYLVGAHLEYLYIGYLISLGLVTVAAGYFIEETAGIDLA
EIQAPGAGSAAL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory