SitesBLAST – Find functional sites

 

SitesBLAST

Comparing AO356_29600 FitnessBrowser__pseudo5_N2C3_1:AO356_29600 to proteins with known functional sites using BLASTp with E ≤ 0.001.

Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures

Found 20 (the maximum) hits to proteins with known functional sites (download)

Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
26% identity, 54% coverage: 26:257/432 of query aligns to 56:272/444 of Q8NLB7

query
sites
Q8NLB7
F
 
Y
D
|
D
W
 
L
T
 
I
L
 
V
Y
 
Y
A
 
G
T
 
T
F
 
V
S
 
Q
V
 
S
Y
 
A
L
 
L
A
 
A
R
 
K
N
 
-
L
 
-
F
 
-
D
 
-
K
 
E
T
 
W
D
 
N
P
 
L
R
 
S
S
 
S
A
 
A
M
 
T
L
 
L
A
 
G
T
 
T
L
 
I
A
 
G
V
 
-
F
 
-
A
 
S
A
 
T
G
 
A
F
 
F
I
 
F
A
 
G
R
 
M
P
 
A
L
 
I
G
 
G
G
 
A
F
 
V
F
 
F
F
 
I
G
 
G
R
 
R
L
 
L
S
 
S
D
 
D
V
x
R
L
 
V
G
 
G
R
 
R
R
 
K
A
 
A
I
 
A
M
 
V
V
 
I
I
 
G
T
 
S
M
 
V
M
 
L
L
 
I
L
 
L
A
 
S
A
 
V
S
 
F
S
 
T
L
 
M
G
 
L
I
 
C
A
 
A
L
 
F
I
 
A
P
 
P
N
 
N
Y
 
P
Q
 
W
D
 
V
I
 
F
G
 
G
L
 
-
Y
 
-
A
 
-
S
 
-
S
 
-
A
 
-
L
 
-
L
 
-
V
 
A
F
 
F
R
 
R
L
 
F
I
 
I
Q
 
A
G
 
G
L
 
L
A
 
G
H
 
L
G
 
G
G
 
G
E
 
L
T
 
V
G
 
P
V
 
S
S
 
V
Y
 
N
T
 
A
Y
 
M
V
 
T
A
 
S
E
 
D
I
 
L
A
 
V
P
 
P
A
 
R
K
 
K
H
 
T
R
 
M
G
 
S
L
 
A
W
 
W
S
 
A
S
 
T
S
 
V
V
 
M
Y
 
M
V
 
S
G
 
G
V
 
V
T
 
P
L
 
I
G
 
G
V
 
-
M
 
-
G
 
-
A
 
-
T
 
G
A
 
S
V
 
I
A
 
A
A
 
A
A
 
V
L
 
L
T
 
A
W
 
-
L
 
L
L
 
V
G
 
V
T
 
V
Q
 
P
A
 
S
T
 
S
G
 
E
D
 
E
Y
 
W
G
 
G
W
 
W
R
 
R
I
 
F
G
 
M
F
 
F
A
 
L
I
 
I
G
 
A
-
 
L
-
 
I
-
 
P
G
 
L
V
 
V
L
 
V
G
 
G
I
 
L
-
 
P
Y
 
I
A
 
A
L
 
M
F
 
K
L
 
V
R
 
I
R
 
P
S
 
S
A
 
D
Q
 
K
E
 
A
S
 
I
H
 
K
V
 
A
F
 
D
E
 
H
Q
 
D
Q
 
I
R
 
R
Q
 
E
Q
 
G
A
 
H
Q
 
D
P
 
E
P
 
P
R
 
A
K
 
G
L
 
F
S
 
K
K
 
D
G
 
L
E
 
L
V
 
V
L
 
D
R
 
R
M
 
Y
T
 
R
R
 
W
N
 
I
I
 
S
V
 
I
M
 
W
L
 
F
A
 
A
A
 
L
A
 
A
A
 
T
N
 
F
V
 
V
T
 
T
Y
 
L
Y
 
L
A
 
A
W
 
W
V
 
Y
T
 
G
F
 
L
G
 
G

Sites not aligning to the query:

P77589 3-(3-hydroxy-phenyl)propionate transporter; 3HPP transporter; 3-(3-hydroxy-phenyl)propionate:H(+) symporter; 3HPP:H(+) symporter from Escherichia coli (strain K12) (see paper)
30% identity, 40% coverage: 58:231/432 of query aligns to 55:212/403 of P77589

query
sites
P77589
V
 
I
F
 
F
A
 
S
A
 
A
G
 
G
F
 
I
I
 
L
A
 
G
R
 
L
P
 
L
L
 
P
G
 
G
G
 
A
F
 
L
F
 
V
F
 
G
G
 
G
R
 
M
L
 
L
S
 
A
D
|
D
V
 
R
L
 
Y
G
 
G
R
 
R
R
 
K
A
 
R
I
 
I
M
 
L
V
 
I
I
 
G
T
 
S
M
 
V
M
 
A
L
 
L
L
 
F
A
 
G
A
 
L
S
 
F
S
 
S
L
 
L
G
 
A
I
 
T
A
 
A
L
 
I
I
 
A
P
 
W
N
 
D
Y
 
F
Q
 
P
D
 
S
I
 
-
G
 
-
L
 
-
Y
 
-
A
 
-
S
 
-
S
 
-
A
 
-
L
 
-
L
 
L
V
 
V
F
 
F
-
 
A
R
 
R
L
 
L
I
 
M
Q
 
T
G
 
G
L
 
V
A
 
G
H
 
L
G
 
G
G
 
A
E
 
A
T
 
L
G
 
P
V
 
N
S
 
L
Y
 
I
T
 
A
Y
 
L
V
 
T
A
 
S
E
 
E
I
 
A
A
 
A
P
 
G
A
 
P
K
 
R
H
 
F
R
 
R
G
 
G
L
 
T
W
 
A
S
 
V
S
 
S
S
 
L
V
 
M
Y
 
Y
V
 
C
G
 
G
V
 
V
T
 
P
L
 
I
G
 
G
V
 
-
M
 
-
G
 
-
A
 
-
T
 
A
A
 
A
V
 
L
A
 
A
A
 
A
A
 
T
L
 
L
T
 
G
W
 
F
L
 
-
L
 
-
G
 
-
T
 
-
Q
 
-
A
 
A
T
 
G
G
 
A
D
 
N
Y
 
L
G
 
A
W
 
W
R
 
Q
I
 
T
G
 
V
F
 
F
A
 
W
I
 
V
G
 
G
G
 
G
V
 
V
L
 
V
G
 
P
-
 
L
I
 
I
Y
 
L
A
 
V
L
 
P
F
 
L
L
 
L
R
 
M
R
 
R
S
 
W
A
 
L
Q
 
P
E
 
E
S
 
S
H
 
A
V
 
V
F
 
F
E
 
A
Q
 
G
Q
 
E
R
 
K
Q
 
Q
Q
 
S
A
 
A
Q
 
P
P
 
P
P
 
L
R
 
R
K
 
A
L
 
L
S
 
F
K
 
A
G
 
P
E
 
E

Sites not aligning to the query:

O08966 Solute carrier family 22 member 1; Organic cation transporter 1; mOCT1 from Mus musculus (Mouse) (see paper)
24% identity, 37% coverage: 68:228/432 of query aligns to 162:319/556 of O08966

query
sites
O08966
L
 
L
G
 
G
G
 
S
F
 
L
F
 
V
F
 
V
G
 
G
R
 
Y
L
 
I
S
 
A
D
 
D
V
 
R
L
 
F
G
 
G
R
 
R
R
 
K
A
 
L
I
 
C
M
 
L
V
 
L
I
 
V
T
 
T
M
 
T
M
 
L
L
 
V
L
 
T
A
 
S
A
 
L
S
 
S
S
 
G
L
 
V
G
 
L
I
 
T
A
 
A
L
 
V
I
 
A
P
 
P
N
 
D
Y
 
Y
Q
 
-
D
 
-
I
 
-
G
 
-
L
 
-
Y
 
-
A
 
-
S
 
-
S
 
T
A
 
S
L
 
M
L
 
L
V
 
L
F
 
F
R
 
R
L
 
L
I
 
L
Q
 
Q
G
 
G
L
 
M
A
 
V
H
 
S
G
 
K
G
 
G
E
 
S
T
 
W
G
 
V
V
 
S
S
 
G
Y
 
Y
T
 
T
Y
 
L
V
 
I
A
 
T
E
 
E
I
 
F
A
 
V
P
 
G
A
 
S
K
 
G
H
 
Y
R
 
R
G
 
R
L
 
T
W
 
T
S
 
A
S
 
I
S
 
L
V
 
Y
Y
 
Q
V
 
V
G
 
A
V
 
F
T
 
T
L
 
V
G
 
G
V
 
L
M
 
V
G
 
G
A
 
L
T
 
A
A
 
G
V
 
V
A
 
A
A
 
Y
A
 
A
L
 
I
T
 
P
-
 
D
-
 
W
-
 
R
W
 
W
L
 
L
L
 
Q
G
 
L
T
 
A
Q
 
V
A
 
S
T
 
L
G
 
P
D
 
T
Y
 
F
G
 
L
W
 
F
R
 
L
I
 
L
G
 
Y
F
 
Y
A
 
W
I
 
F
G
 
V
G
 
P
V
 
E
L
 
S
G
 
P
I
 
R
Y
 
W
A
 
L
L
 
L
F
 
S
L
 
Q
R
 
K
R
 
R
S
 
T
A
 
T
Q
 
Q
E
 
A
S
 
V
H
 
R
V
 
I
F
 
M
E
 
E
Q
 
Q
-
 
I
-
 
A
Q
 
Q
R
 
K
Q
 
N
Q
 
R
A
 
K
Q
 
V
P
 
P
P
 
P
R
 
A
K
 
D
L
 
L
S
 
K

Sites not aligning to the query:

Q5EXK5 3-hydroxybenzoate transporter MhbT from Klebsiella oxytoca (see paper)
32% identity, 34% coverage: 74:222/432 of query aligns to 78:211/452 of Q5EXK5

query
sites
Q5EXK5
G
 
G
R
 
P
L
 
L
S
 
S
D
|
D
V
 
R
L
 
F
G
 
G
R
 
R
R
 
K
A
 
R
I
 
V
M
 
I
V
 
E
I
 
F
T
 
C
M
 
V
M
 
A
L
 
L
L
 
F
A
 
G
A
 
L
S
 
F
S
 
S
L
 
L
G
 
L
I
 
S
A
 
A
L
 
F
I
 
A
P
 
P
N
 
D
Y
 
L
Q
 
Q
D
 
-
I
 
-
G
 
-
L
 
-
Y
 
-
A
 
-
S
 
-
S
 
-
A
 
-
L
 
M
L
 
L
V
 
V
F
 
F
-
 
L
R
 
R
L
 
F
I
 
L
Q
 
T
G
 
G
L
 
L
A
 
G
H
 
L
G
 
G
G
 
G
E
 
A
T
 
M
G
 
P
V
 
N
S
 
T
Y
 
I
T
 
T
Y
 
M
V
 
T
A
 
S
E
 
E
I
 
Y
A
 
L
P
 
P
A
 
A
K
 
R
H
 
R
R
 
R
G
 
G
L
 
A
W
 
L
S
 
V
S
 
T
S
 
L
V
 
M
Y
 
F
V
 
C
G
 
G
V
 
F
T
 
T
L
 
L
G
 
G
V
 
S
M
 
A
G
 
F
A
 
G
T
 
G
A
 
V
V
 
V
A
 
S
A
 
A
A
 
Q
L
 
L
T
 
V
W
 
P
L
 
L
L
 
I
G
 
-
T
 
-
Q
 
-
A
 
-
T
 
-
G
 
-
D
 
-
Y
 
-
G
 
G
W
 
W
R
 
H
I
 
G
G
 
I
F
 
L
A
 
V
I
 
L
G
 
G
G
 
G
V
 
V
L
 
L
G
 
P
-
 
L
I
 
I
Y
 
L
A
 
A
L
 
V
F
 
A
L
 
L
R
 
V
R
 
P
S
 
L
A
 
L
Q
 
P
E
 
E
S
 
S
H
 
P
V
 
R
F
 
W
E
 
Q
Q
 
I
Q
 
R
R
 
R
Q
 
Q
Q
 
L
A
 
P
Q
 
Q

Sites not aligning to the query:

Q9Y7Q9 Probable metabolite transporter C2H8.02 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
25% identity, 38% coverage: 58:223/432 of query aligns to 88:260/583 of Q9Y7Q9

query
sites
Q9Y7Q9
V
 
V
F
 
N
A
 
A
A
 
A
G
 
T
F
 
N
I
 
I
A
 
G
R
 
N
P
 
I
L
 
M
G
 
G
G
 
Q
F
 
L
F
 
L
F
 
F
G
 
G
R
 
F
L
 
L
S
 
G
D
 
D
V
 
F
L
 
F
G
 
G
R
 
R
R
 
K
A
 
F
I
 
V
M
 
Y
V
 
G
I
 
K
T
 
E
M
 
M
M
 
M
L
 
V
L
 
V
A
 
I
A
 
I
S
 
A
S
 
T
L
 
I
G
 
L
I
 
I
A
 
I
L
 
C
I
 
L
P
 
P
N
 
D
Y
 
R
Q
 
I
D
 
P
I
 
T
G
 
P
L
 
T
Y
 
A
A
 
K
S
 
M
S
 
M
A
 
W
L
 
L
L
 
F
V
 
A
F
 
F
R
 
R
L
 
V
I
 
M
Q
 
L
G
 
G
L
 
I
A
 
G
H
 
I
G
 
G
G
 
G
E
 
D
T
 
Y
G
 
P
V
 
M
S
 
S
Y
 
A
T
 
S
Y
 
I
V
 
T
A
 
S
E
 
E
I
 
Q
A
 
S
P
 
L
A
 
I
K
 
N
H
 
R
R
 
R
G
 
G
L
 
A
W
 
L
S
 
L
S
 
A
S
 
W
V
 
I
Y
 
F
V
 
S
G
 
N
V
 
Q
T
 
G
L
 
W
G
 
G
V
 
T
M
 
L
G
 
-
A
 
A
T
 
G
A
 
C
V
 
V
A
 
A
A
 
T
A
 
L
L
 
I
T
 
I
W
 
L
L
 
A
L
 
C
G
 
F
T
 
E
Q
 
K
A
 
P
T
 
L
G
 
N
D
 
D
Y
 
R
G
 
G
-
 
E
-
 
Y
-
 
T
-
 
K
-
 
L
-
 
N
-
 
G
-
 
V
W
 
W
R
 
R
I
 
I
G
 
Q
F
 
F
A
 
G
I
 
I
G
 
A
G
 
L
V
 
F
L
 
P
G
 
A
I
 
V
Y
 
I
A
 
V
L
 
L
F
 
I
L
 
P
R
 
R
R
 
L
S
 
R
A
 
M
Q
 
Q
E
 
E
S
 
S
H
 
E
V
 
Q
F
 
F
E
 
K
Q
 
N
Q
 
S
R
 
K
Q
 
N
Q
 
M
A
 
K
Q
 
S
P
 
P

Sites not aligning to the query:

A0A0H2VG78 Glucose transporter GlcP; Glucose/H(+) symporter from Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) (see paper)
24% identity, 81% coverage: 74:423/432 of query aligns to 63:434/446 of A0A0H2VG78

query
sites
A0A0H2VG78
G
 
G
R
 
P
L
 
L
S
 
A
D
 
D
V
 
K
L
 
L
G
 
G
R
 
R
R
 
R
A
 
R
I
 
L
M
 
V
V
 
M
I
 
L
T
 
I
M
 
A
M
 
I
L
 
V
L
 
F
A
 
I
A
 
I
S
 
G
S
 
A
L
 
L
G
 
I
I
 
L
A
 
A
L
 
A
I
 
S
P
 
T
N
 
N
Y
 
L
Q
 
-
D
 
-
I
 
-
G
 
-
L
 
-
Y
 
-
A
 
-
S
 
-
S
 
A
A
 
L
L
 
L
L
 
I
V
 
I
F
 
G
R
|
R
L
 
L
I
 
I
Q
x
I
G
 
G
L
 
L
A
 
A
H
 
V
G
 
G
G
 
G
E
 
S
T
 
M
G
 
S
V
 
T
S
 
V
Y
 
P
T
 
V
Y
 
Y
V
 
L
A
 
S
E
|
E
I
 
M
A
 
A
P
 
P
A
 
T
K
 
E
H
 
Y
R
 
R
G
 
G
L
 
S
W
 
L
S
 
G
S
 
S
S
 
L
V
 
N
Y
x
Q
V
 
L
G
 
M
V
 
I
T
 
T
L
 
I
G
 
G
V
 
I
M
 
L
G
 
A
A
 
A
T
 
Y
A
 
L
V
 
V
A
 
N
A
 
Y
A
 
A
L
 
F
T
 
A
W
 
D
L
 
I
L
 
E
G
 
G
T
 
-
Q
 
-
A
 
-
T
 
-
G
 
-
D
 
-
Y
 
W
G
 
R
W
 
W
R
 
M
I
 
L
G
 
G
F
 
L
A
 
A
I
 
V
G
 
V
G
 
P
-
 
S
-
 
V
-
 
I
-
 
L
V
 
L
L
 
V
G
 
G
I
 
I
Y
 
Y
A
 
-
L
 
-
F
 
F
L
 
M
R
 
P
R
 
E
S
 
S
A
 
P
Q
 
R
-
 
W
-
 
L
-
 
L
E
 
E
S
 
N
H
 
R
V
 
N
F
 
E
E
 
E
Q
 
A
Q
 
A
R
 
R
Q
 
Q
Q
 
V
A
 
M
Q
 
K
P
 
I
P
 
T
R
 
Y
K
 
D
L
 
D
S
 
S
K
 
E
-
 
I
G
 
D
E
 
K
V
 
E
L
 
L
R
 
K
M
 
E
T
 
M
R
 
K
N
 
E
I
 
I
V
 
N
M
 
A
L
 
I
A
 
S
A
 
E
A
 
S
A
 
T
-
 
W
N
 
T
V
 
V
T
 
I
Y
 
K
Y
 
S
A
 
P
W
 
W
-
 
L
-
 
G
-
 
R
-
 
I
V
 
L
T
 
I
F
 
V
G
 
G
A
 
C
A
 
I
S
 
F
A
 
A
I
 
I
A
 
F
Q
|
Q
-
x
Q
-
 
F
-
 
I
G
 
G
M
 
I
D
x
N
A
 
A
T
 
V
G
 
I
A
 
F
Y
 
Y
L
 
S
A
 
S
S
 
S
L
 
I
L
 
F
A
 
A
Q
 
K
-
 
A
-
 
G
-
 
L
-
 
G
-
 
E
-
 
A
-
 
A
-
 
S
-
 
I
-
 
L
-
 
G
-
 
S
-
 
V
-
 
G
-
 
I
-
 
G
V
 
T
I
 
I
C
 
N
V
 
V
C
 
L
W
 
V
L
 
T
P
 
I
V
 
V
C
 
A
G
 
I
M
 
F
L
 
V
S
 
V
D
 
D
R
 
K
V
 
I
G
 
D
R
 
R
K
 
K
P
 
K
M
 
L
V
 
L
I
 
V
A
 
G
W
 
G
G
 
N
I
 
I
G
 
G
V
 
M
V
 
I
-
 
A
-
 
S
-
 
L
-
 
L
-
 
I
-
 
M
-
 
A
V
 
I
L
 
L
T
 
I
Y
 
W
P
 
T
I
 
I
S
 
G
-
 
I
-
 
A
-
 
S
-
 
S
-
 
A
-
 
W
-
 
I
I
 
I
I
 
I
V
 
V
T
 
C
T
 
L
E
 
S
P
 
L
Y
 
F
T
 
I
L
 
V
F
 
F
L
 
F
A
 
G
Q
 
I
A
 
S
L
 
W
A
 
G
L
 
P
L
 
V
A
 
L
W
|
W
A
 
-
S
 
-
I
 
-
A
 
-
A
 
-
I
 
-
F
 
-
P
 
-
A
 
V
V
 
M
L
 
L
S
 
P
E
 
E
Q
 
L
V
 
F
P
 
P
T
 
M
Q
 
R
A
 
A
R
 
R
A
 
G
Q
 
A
S
 
A
V
 
T
G
 
G
-
 
I
-
 
S
-
 
A
F
 
L
V
 
V
S
 
L
S
 
N
V
 
I
S
 
G
V
 
T
A
 
L
I
 
I
F
 
V
G
 
S
G
 
L
T
 
F
A
 
F
P
 
P
Y
 
I
L
 
L
H
 
S
S
 
D
Y
 
A
L
 
L
V
 
-
G
 
S
A
 
T
H
 
E
L
 
W
E
 
V
Y
 
F
L
 
L
Y
 
I
I
 
F
G
 
A
Y
 
F
L
 
I
I
 
G
S
 
V
L
 
L
G
 
A
L
 
M
V
 
I
T
 
F
V
 
V
A
 
I
A
 
K
G
 
-
Y
 
-
F
 
F
I
 
L
E
 
P
E
 
E
T
 
T
A
 
R
G
 
G
I
 
R
D
 
S
L
 
L
A
 
E
E
 
E
I
 
I
Q
 
E

Sites not aligning to the query:

P25297 Inorganic phosphate transporter PHO84 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 6 papers)
26% identity, 33% coverage: 68:211/432 of query aligns to 117:273/587 of P25297

query
sites
P25297
L
 
I
G
 
G
G
 
Q
F
 
F
F
 
G
F
 
F
G
 
G
R
 
T
L
 
L
S
 
A
D
 
D
V
 
I
L
 
V
G
 
G
R
 
R
R
 
K
A
 
R
I
 
I
M
 
Y
V
 
G
I
 
M
T
 
E
M
 
L
M
 
I
L
 
I
L
 
M
A
 
I
A
 
V
S
x
C
S
 
T
L
 
I
G
 
L
I
 
Q
A
 
T
L
 
T
I
 
V
P
 
A
N
 
H
Y
 
S
Q
 
P
D
 
A
I
 
I
G
 
N
L
x
F
Y
 
V
A
 
A
S
 
-
S
 
-
A
 
V
L
 
L
L
 
T
V
 
F
F
 
Y
R
|
R
L
 
I
I
 
V
Q
 
M
G
|
G
L
 
I
A
x
G
H
 
I
G
|
G
G
 
G
E
x
D
T
x
Y
G
 
P
V
 
L
S
 
S
Y
 
S
T
 
I
Y
 
I
V
 
T
A
 
S
E
 
E
I
 
F
A
 
A
P
 
T
A
 
T
K
 
K
H
 
W
R
 
R
G
 
G
L
 
A
W
 
I
S
 
M
S
 
G
S
 
A
V
 
V
Y
 
F
V
 
A
G
 
N
-
 
Q
-
 
A
-
 
W
-
 
G
-
 
Q
V
 
I
T
 
S
L
 
G
G
 
G
V
 
I
M
 
I
G
 
A
A
 
L
T
 
I
A
 
L
V
 
V
A
 
A
A
 
A
A
 
Y
L
 
K
T
 
G
W
 
E
L
 
L
-
 
E
-
 
Y
-
 
A
-
 
N
-
 
S
-
 
G
-
 
A
-
 
E
-
x
C
-
 
D
L
 
A
G
 
R
T
x
C
Q
 
Q
A
 
K
T
 
A
G
x
C
D
 
D
Y
 
Q
G
 
M
W
 
W
R
 
R
I
 
I
G
 
L
F
 
I
A
 
G
I
 
L
G
 
G
G
 
T
V
 
V
L
 
L
G
 
G
I
 
L
Y
 
A
A
x
C
L
 
L
F
 
Y
L
 
F
R
 
R
R
 
L
S
 
T
A
 
I
Q
 
P
E
 
E
S
 
S

Sites not aligning to the query:

8et9A Cryo-em structure of the organic cation transporter 2 in complex with 1-methyl-4-phenylpyridinium (see paper)
33% identity, 18% coverage: 70:148/432 of query aligns to 157:232/517 of 8et9A

query
sites
8et9A
G
 
G
F
 
F
F
 
F
F
 
V
G
 
G
R
 
S
L
 
M
S
 
S
-
 
I
-
 
G
-
 
Y
-
 
I
-
 
A
D
 
D
V
 
R
L
 
F
G
 
G
R
 
R
R
 
K
A
 
L
I
 
C
M
 
L
V
 
L
I
 
V
T
 
T
M
 
I
M
 
L
L
 
I
L
 
N
A
 
A
A
 
I
S
 
S
S
 
G
L
 
V
G
 
L
I
 
M
A
 
A
L
 
V
I
 
A
P
 
P
N
 
N
Y
 
Y
Q
 
-
D
 
-
I
 
-
G
 
-
L
 
-
Y
 
-
A
 
-
S
 
-
S
 
T
A
 
W
L
 
M
L
 
L
V
 
I
F
 
F
R
 
R
L
 
L
I
 
I
Q
 
Q
G
 
G
L
 
L
A
 
V
H
 
S
G
 
K
G
 
G
E
 
G
T
x
W
G
 
L
V
 
I
S
 
G
Y
 
Y
T
 
T
Y
 
L
V
 
P
A
 
T
E
 
E
I
 
F
A
 
V
P
 
G
A
 
L
K
 
E
H
 
Y
R
 
R

Sites not aligning to the query:

Q63089 Solute carrier family 22 member 1; Organic cation transporter 1; rOCT1 from Rattus norvegicus (Rat) (see 4 papers)
26% identity, 25% coverage: 68:173/432 of query aligns to 162:259/556 of Q63089

query
sites
Q63089
L
 
L
G
 
G
G
 
S
F
 
L
F
 
V
F
 
V
G
 
G
R
 
Y
L
 
I
S
 
A
D
 
D
V
 
R
L
 
F
G
 
G
R
 
R
R
 
K
A
 
L
I
x
C
M
 
L
V
 
L
I
 
V
T
 
T
M
 
T
M
 
L
L
 
V
L
 
T
A
 
S
A
 
V
S
 
S
S
 
G
L
 
V
G
 
L
I
 
T
A
 
A
L
 
V
I
 
A
P
 
P
N
 
D
Y
 
Y
Q
 
-
D
 
-
I
 
-
G
 
-
L
 
-
Y
 
-
A
 
-
S
 
-
S
 
T
A
 
S
L
 
M
L
 
L
V
 
L
F
 
F
R
 
R
L
 
L
I
 
L
Q
 
Q
G
 
G
L
x
M
A
x
V
H
x
S
G
x
K
G
|
G
E
x
S
T
x
W
G
x
V
V
x
S
S
x
G
Y
|
Y
T
|
T
Y
x
L
V
x
I
A
x
T
E
|
E
I
x
F
A
x
V
P
 
G
A
 
S
K
 
G
H
 
Y
R
 
R
G
 
R
L
 
T
W
 
T
S
 
A
S
 
I
S
 
L
V
 
Y
Y
 
Q
V
 
M
G
 
A
V
 
F
T
 
T
L
 
V
G
 
G
V
 
L
M
 
V
G
 
G
A
 
L
T
 
A
A
 
G
V
 
V
A
 
A
A
 
Y
A
 
A
L
 
I

Sites not aligning to the query:

O15245 Solute carrier family 22 member 1; Organic cation transporter 1; hOCT1 from Homo sapiens (Human) (see 10 papers)
30% identity, 24% coverage: 70:173/432 of query aligns to 158:258/554 of O15245

query
sites
O15245
G
 
G
F
 
F
F
x
L
F
 
F
G
 
G
R
 
S
L
 
L
-
 
G
-
 
V
-
 
G
-
 
Y
-
 
F
S
 
A
D
 
D
V
 
R
L
 
F
G
 
G
R
 
R
R
 
K
A
 
L
I
 
C
M
 
L
V
 
L
I
 
G
T
 
T
M
 
V
M
 
L
L
 
V
L
 
N
A
 
A
A
 
V
S
|
S
S
 
G
L
 
V
G
 
L
I
 
M
A
 
A
L
 
F
I
 
S
P
 
P
N
 
N
Y
 
Y
Q
 
M
D
 
-
I
 
-
G
 
-
L
 
-
Y
 
-
A
 
-
S
 
-
S
 
-
A
 
S
L
 
M
L
 
L
V
 
L
F
 
F
R
 
R
L
 
L
I
 
L
Q
 
Q
G
 
G
L
 
L
A
 
V
H
 
S
G
 
K
G
 
G
E
 
N
T
 
W
G
 
M
V
 
A
S
x
G
Y
 
Y
T
 
T
Y
 
L
V
 
I
A
 
T
E
 
E
I
 
F
A
 
V
P
 
G
A
 
S
K
 
G
H
 
S
R
 
R
G
 
R
L
 
T
W
 
V
S
 
A
S
 
I
S
 
M
V
x
Y
Y
 
Q
V
 
M
G
 
A
V
 
F
T
 
T
L
 
V
G
 
G
V
 
L
M
 
V
G
 
A
A
 
L
T
 
T
A
 
G
V
 
L
A
 
A
A
 
Y
A
 
A
L
 
L

Sites not aligning to the query:

8jtzA Hoct1 in complex with spironolactone in outward facing partially occluded conformation (see paper)
30% identity, 24% coverage: 70:173/432 of query aligns to 156:256/530 of 8jtzA

query
sites
8jtzA
G
 
G
F
 
F
F
 
L
F
 
F
G
 
G
R
 
S
L
 
L
-
 
G
-
 
V
-
 
G
-
 
Y
-
 
F
S
 
A
D
 
D
V
 
R
L
 
F
G
 
G
R
 
R
R
 
K
A
 
L
I
 
C
M
 
L
V
 
L
I
 
G
T
 
T
M
 
V
M
 
L
L
 
V
L
 
N
A
 
A
A
 
V
S
 
S
S
 
G
L
 
V
G
 
L
I
 
M
A
 
A
L
 
F
I
 
S
P
 
P
N
 
N
Y
 
Y
Q
 
M
D
 
-
I
 
-
G
 
-
L
 
-
Y
 
-
A
 
-
S
 
-
S
 
-
A
 
S
L
 
M
L
 
L
V
 
L
F
 
F
R
 
R
L
 
L
I
 
L
Q
 
Q
G
 
G
L
 
L
A
 
V
H
 
S
G
x
K
G
 
G
E
 
N
T
x
W
G
 
M
V
 
A
S
 
G
Y
 
Y
T
 
T
Y
 
L
V
 
I
A
 
T
E
 
E
I
 
F
A
 
V
P
 
G
A
 
S
K
 
G
H
 
S
R
 
R
G
 
R
L
 
T
W
 
V
S
 
A
S
 
I
S
 
M
V
 
Y
Y
x
Q
V
 
M
G
 
A
V
x
F
T
 
T
L
 
V
G
 
G
V
 
L
M
 
V
G
 
A
A
 
L
T
 
T
A
 
G
V
 
L
A
 
A
A
 
Y
A
 
A
L
 
L

Sites not aligning to the query:

8jttA Hoct1 in complex with metformin in outward occluded conformation (see paper)
30% identity, 24% coverage: 70:173/432 of query aligns to 80:180/454 of 8jttA

query
sites
8jttA
G
 
G
F
 
F
F
 
L
F
 
F
G
 
G
R
 
S
L
 
L
-
 
G
-
 
V
-
 
G
-
 
Y
-
 
F
S
 
A
D
 
D
V
 
R
L
 
F
G
 
G
R
 
R
R
 
K
A
 
L
I
 
C
M
 
L
V
 
L
I
 
G
T
 
T
M
 
V
M
 
L
L
 
V
L
 
N
A
 
A
A
 
V
S
 
S
S
 
G
L
 
V
G
 
L
I
 
M
A
 
A
L
 
F
I
 
S
P
 
P
N
 
N
Y
 
Y
Q
 
M
D
 
-
I
 
-
G
 
-
L
 
-
Y
 
-
A
 
-
S
 
-
S
 
-
A
 
S
L
 
M
L
 
L
V
 
L
F
 
F
R
 
R
L
 
L
I
 
L
Q
 
Q
G
 
G
L
 
L
A
 
V
H
 
S
G
 
K
G
 
G
E
 
N
T
 
W
G
 
M
V
 
A
S
 
G
Y
 
Y
T
 
T
Y
 
L
V
 
I
A
 
T
E
 
E
I
 
F
A
 
V
P
 
G
A
 
S
K
 
G
H
 
S
R
 
R
G
 
R
L
 
T
W
 
V
S
 
A
S
 
I
S
 
M
V
 
Y
Y
 
Q
V
 
M
G
 
A
V
 
F
T
 
T
L
 
V
G
 
G
V
 
L
M
 
V
G
 
A
A
 
L
T
 
T
A
 
G
V
 
L
A
 
A
A
 
Y
A
 
A
L
 
L

Sites not aligning to the query:

Q51330 Oxalate:formate antiporter; OFA; Oxalate:formate antiport protein; Oxalate:formate exchange protein from Oxalobacter formigenes (see 4 papers)
26% identity, 41% coverage: 201:375/432 of query aligns to 189:363/418 of Q51330

query
sites
Q51330
A
 
A
L
 
F
F
 
V
L
 
I
R
 
R
R
 
F
S
 
P
A
 
G
Q
 
Q
E
 
Q
S
 
G
H
 
-
V
 
-
F
 
-
E
 
-
Q
 
A
Q
 
K
R
 
K
Q
 
Q
Q
 
I
A
 
V
Q
 
V
P
 
T
P
 
D
R
 
K
K
 
D
L
 
F
S
 
N
K
 
S
G
 
G
E
 
E
V
 
M
L
 
L
R
 
R
M
 
T
T
 
P
R
 
Q
N
 
F
I
 
W
V
 
V
M
 
L
L
 
W
A
 
T
A
 
A
A
 
F
A
 
F
N
 
S
V
 
V
T
 
N
Y
 
F
Y
 
G
A
 
G
W
 
L
-
 
L
-
 
L
-
 
V
-
 
A
-
 
N
-
 
S
V
 
V
T
 
P
F
 
Y
G
 
G
A
 
R
A
 
S
S
 
L
A
 
G
I
 
L
A
 
A
Q
 
A
G
 
G
M
 
V
D
 
L
A
 
T
T
 
I
G
 
G
A
 
V
Y
 
S
L
 
I
A
 
Q
S
 
N
L
 
L
L
 
F
A
 
N
Q
 
G
V
 
G
I
x
C
C
 
R
V
 
P
C
 
F
W
 
W
L
 
-
P
 
-
V
 
-
C
 
-
G
 
G
M
 
F
L
 
V
S
 
S
D
 
D
R
 
K
V
 
I
G
 
G
R
 
R
-
 
Y
K
 
K
P
 
T
M
 
M
V
 
S
I
 
V
A
 
V
W
 
F
G
 
G
I
 
I
G
 
N
V
 
A
V
 
V
V
 
V
L
 
L
T
 
A
Y
 
L
P
 
F
I
 
P
S
 
T
I
 
I
I
 
A
V
 
A
T
 
L
T
 
G
E
 
D
P
 
-
Y
 
-
T
 
V
L
 
A
F
 
F
L
 
I
A
 
A
Q
 
M
-
 
L
A
 
A
L
 
I
A
 
A
L
 
F
L
 
F
A
 
T
W
 
W
A
 
G
S
 
G
I
 
S
A
 
Y
A
 
A
I
 
L
F
 
F
P
 
P
A
 
S
V
 
T
L
 
N
S
 
S
E
 
D
Q
 
I
V
 
F
P
 
G
T
 
T
Q
 
A
A
 
Y
R
 
S
A
 
A
Q
 
R
S
 
N
V
 
Y
G
|
G
F
 
F
V
 
F
-
 
W
-
 
A
S
 
A
S
x
K
V
 
A
S
 
T
V
 
A
A
 
S
I
 
I
F
 
F
G
|
G
G
|
G

Sites not aligning to the query:

8sc2A Human oct1 bound to diltiazem in inward-open conformation (see paper)
30% identity, 24% coverage: 70:173/432 of query aligns to 140:240/453 of 8sc2A

query
sites
8sc2A
G
 
G
F
 
F
F
 
L
F
 
F
G
 
G
R
 
S
L
 
L
-
 
G
-
 
V
-
 
G
-
 
Y
-
 
F
S
 
A
D
 
D
V
 
R
L
 
F
G
 
G
R
 
R
R
 
K
A
 
L
I
 
C
M
 
L
V
 
L
I
 
G
T
 
T
M
 
V
M
 
L
L
 
V
L
 
N
A
 
A
A
 
V
S
 
S
S
 
G
L
 
V
G
 
L
I
 
M
A
 
A
L
 
F
I
 
S
P
 
P
N
 
N
Y
 
Y
Q
 
M
D
 
-
I
 
-
G
 
-
L
 
-
Y
 
-
A
 
-
S
 
-
S
 
-
A
 
S
L
 
M
L
 
L
V
 
L
F
 
F
R
 
R
L
 
L
I
 
L
Q
 
Q
G
 
G
L
 
L
A
 
V
H
 
S
G
 
K
G
 
G
E
 
N
T
x
W
G
 
M
V
 
A
S
 
G
Y
 
Y
T
 
T
Y
 
L
V
 
I
A
 
T
E
 
E
I
 
F
A
 
V
P
 
G
A
 
S
K
 
G
H
 
S
R
 
R
G
 
R
L
 
T
W
 
V
S
 
A
S
 
I
S
 
M
V
 
Y
Y
x
Q
V
 
M
G
 
A
V
x
F
T
 
T
L
 
V
G
 
G
V
 
L
M
 
V
G
 
A
A
 
L
T
 
T
A
 
G
V
 
L
A
 
A
A
 
Y
A
 
A
L
 
L

Sites not aligning to the query:

8sc6A Human oct1 bound to thiamine in inward-open conformation (see paper)
30% identity, 24% coverage: 70:173/432 of query aligns to 140:240/447 of 8sc6A

query
sites
8sc6A
G
 
G
F
 
F
F
 
L
F
 
F
G
 
G
R
 
S
L
 
L
-
 
G
-
 
V
-
 
G
-
 
Y
-
 
F
S
 
A
D
 
D
V
 
R
L
 
F
G
 
G
R
 
R
R
 
K
A
 
L
I
 
C
M
 
L
V
 
L
I
 
G
T
 
T
M
 
V
M
 
L
L
 
V
L
 
N
A
 
A
A
 
V
S
 
S
S
 
G
L
 
V
G
 
L
I
 
M
A
 
A
L
 
F
I
 
S
P
 
P
N
 
N
Y
 
Y
Q
 
M
D
 
-
I
 
-
G
 
-
L
 
-
Y
 
-
A
 
-
S
 
-
S
 
-
A
 
S
L
 
M
L
 
L
V
 
L
F
 
F
R
 
R
L
 
L
I
 
L
Q
 
Q
G
 
G
L
 
L
A
 
V
H
 
S
G
 
K
G
 
G
E
 
N
T
 
W
G
 
M
V
 
A
S
 
G
Y
 
Y
T
 
T
Y
 
L
V
 
I
A
 
T
E
 
E
I
 
F
A
 
V
P
 
G
A
 
S
K
 
G
H
 
S
R
 
R
G
 
R
L
 
T
W
 
V
S
 
A
S
 
I
S
 
M
V
 
Y
Y
x
Q
V
 
M
G
 
A
V
x
F
T
 
T
L
 
V
G
 
G
V
 
L
M
 
V
G
 
A
A
 
L
T
 
T
A
 
G
V
 
L
A
 
A
A
 
Y
A
 
A
L
 
L

Sites not aligning to the query:

8sc3A Human oct1 bound to fenoterol in inward-open conformation (see paper)
30% identity, 24% coverage: 70:173/432 of query aligns to 140:240/445 of 8sc3A

query
sites
8sc3A
G
 
G
F
 
F
F
 
L
F
 
F
G
 
G
R
 
S
L
 
L
-
 
G
-
 
V
-
 
G
-
 
Y
-
 
F
S
 
A
D
 
D
V
 
R
L
 
F
G
 
G
R
 
R
R
 
K
A
 
L
I
 
C
M
 
L
V
 
L
I
 
G
T
 
T
M
 
V
M
 
L
L
 
V
L
 
N
A
 
A
A
 
V
S
 
S
S
 
G
L
 
V
G
 
L
I
 
M
A
 
A
L
 
F
I
 
S
P
 
P
N
 
N
Y
 
Y
Q
 
M
D
 
-
I
 
-
G
 
-
L
 
-
Y
 
-
A
 
-
S
 
-
S
 
-
A
 
S
L
 
M
L
 
L
V
 
L
F
 
F
R
 
R
L
 
L
I
 
L
Q
 
Q
G
 
G
L
 
L
A
 
V
H
 
S
G
 
K
G
 
G
E
 
N
T
x
W
G
x
M
V
 
A
S
 
G
Y
 
Y
T
 
T
Y
 
L
V
 
I
A
 
T
E
 
E
I
 
F
A
 
V
P
 
G
A
 
S
K
 
G
H
 
S
R
 
R
G
 
R
L
 
T
W
 
V
S
 
A
S
 
I
S
 
M
V
 
Y
Y
x
Q
V
 
M
G
 
A
V
x
F
T
 
T
L
 
V
G
 
G
V
 
L
M
 
V
G
 
A
A
 
L
T
 
T
A
 
G
V
 
L
A
 
A
A
 
Y
A
 
A
L
 
L

Sites not aligning to the query:

Q8MJI6 Solute carrier family 22 member 2; Organic cation transporter 2 from Oryctolagus cuniculus (Rabbit) (see paper)
30% identity, 24% coverage: 70:173/432 of query aligns to 158:258/554 of Q8MJI6

query
sites
Q8MJI6
G
 
G
F
 
F
F
 
F
F
 
I
G
 
G
R
 
S
-
 
V
-
 
G
-
 
I
-
 
G
-
 
Y
L
 
L
S
 
A
D
 
D
V
 
R
L
 
F
G
 
G
R
 
R
R
 
K
A
 
L
I
 
C
M
 
L
V
 
L
I
 
V
T
 
T
M
 
I
M
 
L
L
 
I
L
 
N
A
 
A
A
 
A
S
 
A
S
 
G
L
 
V
G
 
L
I
 
M
A
 
A
L
 
V
I
 
S
P
 
P
N
 
N
Y
 
Y
Q
 
-
D
 
-
I
 
-
G
 
-
L
 
-
Y
 
-
A
 
-
S
 
-
S
 
T
A
 
W
L
 
M
L
 
L
V
 
I
F
 
F
R
 
R
L
 
L
I
 
I
Q
 
Q
G
 
G
L
 
L
A
 
V
H
 
S
G
 
K
G
 
A
E
 
G
T
 
W
G
 
L
V
 
I
S
 
G
Y
 
Y
T
 
I
Y
 
L
V
 
I
A
 
T
E
 
E
I
 
F
A
 
V
P
 
G
A
 
L
K
 
N
H
 
Y
R
 
R
G
 
R
L
 
T
W
 
V
S
 
G
S
 
I
S
 
L
V
 
Y
Y
 
Q
V
 
V
G
 
A
V
 
F
T
 
T
L
 
V
G
 
G
V
 
L
M
 
L
G
 
V
A
 
L
T
 
A
A
 
G
V
 
V
A
 
A
A
 
Y
A
 
A
L
 
L

Sites not aligning to the query:

Q51955 4-hydroxybenzoate transporter PcaK from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 2 papers)
27% identity, 32% coverage: 58:195/432 of query aligns to 69:190/448 of Q51955

query
sites
Q51955
V
 
V
F
 
M
A
 
S
A
 
A
G
 
A
F
 
L
I
 
I
A
 
G
R
 
M
P
 
V
L
 
F
G
 
G
G
 
A
F
 
L
F
 
G
F
 
S
G
|
G
R
 
P
L
 
L
S
 
A
D
|
D
V
 
R
L
 
F
G
|
G
R
 
R
R
 
K
A
 
G
I
 
V
M
 
L
V
 
V
I
 
G
T
 
A
M
 
V
M
 
L
L
 
V
L
 
F
A
 
G
A
 
G
S
 
F
S
 
S
L
 
L
G
 
A
I
 
S
A
 
A
L
 
Y
I
 
A
P
 
T
N
 
N
Y
 
V
Q
 
D
D
 
Q
I
 
-
G
 
-
L
 
-
Y
 
-
A
 
-
S
 
-
S
 
-
A
 
-
L
 
L
L
 
L
V
 
V
F
 
L
R
|
R
L
 
F
I
 
L
Q
 
T
G
 
G
L
 
L
A
 
G
H
 
L
G
 
G
G
 
A
E
 
G
T
 
M
G
 
P
V
 
N
S
 
A
Y
 
T
T
 
T
Y
 
L
V
 
L
A
 
S
E
|
E
I
 
Y
A
 
T
P
 
P
A
 
E
K
 
R
H
 
L
R
 
K
G
 
S
L
 
L
W
 
L
S
 
V
S
 
T
S
 
S
V
 
M
Y
 
F
V
 
C
G
 
G
V
 
F
T
 
N
L
 
L
G
 
G
V
 
M
M
 
A
G
 
G
A
 
G
T
 
G
A
 
F
V
 
I
A
 
S
A
 
A
A
 
K
L
 
M
T
 
-
W
 
-
L
 
-
L
 
-
G
 
-
T
 
-
Q
 
-
A
 
-
T
 
I
G
 
P
D
 
A
Y
 
Y
G
 
G
W
 
W
R
x
H
I
 
S
G
 
L
F
 
L
A
 
V
I
 
I
G
 
G
G
 
G

Sites not aligning to the query:

8hpkA Crystal structure of the bacterial oxalate transporter oxlt in an oxalate-bound occluded form (see paper)
27% identity, 37% coverage: 218:375/432 of query aligns to 187:348/390 of 8hpkA

query
sites
8hpkA
R
 
Q
Q
 
Q
Q
 
I
A
 
V
Q
 
V
P
 
T
P
 
D
R
 
K
K
 
D
L
 
F
S
 
N
K
 
S
G
 
G
E
 
E
V
 
M
L
 
L
R
 
R
M
 
T
T
 
P
R
 
Q
N
 
F
I
 
W
V
 
V
M
 
L
L
 
W
A
 
T
A
 
A
A
 
F
A
 
F
N
 
S
V
 
V
T
 
N
Y
 
F
Y
 
G
A
 
G
W
 
L
-
 
L
-
 
L
-
 
V
-
 
A
-
 
N
-
 
S
V
 
V
T
 
P
F
 
Y
G
 
G
A
 
R
A
 
S
S
 
L
A
 
G
I
 
L
A
 
A
Q
 
A
G
 
G
M
 
V
D
 
L
A
 
T
T
 
I
G
 
G
A
 
V
Y
 
S
L
 
I
A
 
Q
S
 
N
L
 
L
L
 
F
A
 
N
Q
 
G
V
 
G
I
 
-
C
 
-
V
 
-
C
 
C
W
 
-
L
x
R
P
 
P
V
 
F
C
 
W
G
 
G
M
 
F
L
 
V
S
 
S
D
 
D
R
 
K
V
 
I
G
 
G
R
 
R
-
 
Y
K
 
K
P
 
T
M
 
M
V
 
S
I
 
V
A
 
V
W
 
F
G
 
G
I
 
I
G
 
N
V
 
A
V
 
V
V
 
V
L
 
L
T
 
A
Y
 
L
P
 
F
I
 
P
S
 
T
I
 
I
I
 
A
V
 
A
T
 
L
T
 
G
E
 
D
P
 
-
Y
 
-
T
 
V
L
 
A
F
 
F
L
 
I
A
 
A
Q
 
M
-
 
L
A
 
A
L
 
I
A
 
A
L
 
F
L
 
F
A
 
T
W
 
W
A
 
G
S
 
G
I
 
S
A
x
Y
A
 
A
I
 
L
F
 
F
P
 
P
A
 
S
V
 
T
L
 
N
S
 
S
E
 
D
Q
 
I
V
 
F
P
 
G
T
 
T
Q
 
A
A
 
Y
R
 
S
A
 
A
Q
 
R
S
 
N
V
 
Y
G
 
G
F
 
F
V
 
F
-
 
W
-
 
A
S
 
A
S
x
K
V
 
A
S
 
T
V
 
A
A
 
S
I
 
I
F
 
F
G
 
G
G
 
G

Sites not aligning to the query:

7spsA Crystal structure of human glucose transporter glut3 bound with exofacial inhibitor sa47 (see paper)
26% identity, 33% coverage: 37:180/432 of query aligns to 38:178/468 of 7spsA

query
sites
7spsA
Y
 
F
L
 
I
A
 
T
R
 
K
N
 
T
L
 
L
F
 
T
D
 
D
K
 
K
T
 
G
D
 
N
-
 
A
-
 
P
P
 
P
R
 
S
S
 
E
A
 
V
M
 
L
L
 
L
A
 
T
T
 
S
L
 
L
-
 
W
-
 
S
-
 
L
-
 
S
-
 
V
A
 
A
V
 
I
F
 
F
A
 
S
A
 
V
G
 
G
F
 
G
I
 
M
A
 
-
R
 
-
P
 
-
L
 
I
G
 
G
G
 
S
F
 
F
F
 
S
F
 
V
G
 
G
R
 
L
L
 
F
S
 
V
D
 
N
V
 
R
L
 
F
G
 
G
R
 
R
R
 
R
A
 
N
I
 
S
M
 
M
V
 
L
I
 
I
T
 
V
M
 
N
M
 
L
L
 
L
L
 
A
A
 
V
A
 
T
S
 
G
S
 
G
L
 
C
G
 
F
I
 
M
A
 
G
L
 
L
I
 
C
P
 
K
N
 
V
Y
 
A
Q
 
K
D
 
S
I
 
V
G
 
E
L
 
M
Y
 
-
A
 
-
S
 
-
S
 
-
A
 
-
L
 
L
L
 
I
V
 
L
F
 
G
R
 
R
L
 
L
I
 
V
Q
 
I
G
 
G
L
 
L
A
 
F
H
 
C
G
 
G
G
 
L
E
 
C
T
 
T
G
 
G
V
 
F
S
 
V
Y
 
P
T
 
M
Y
 
Y
V
 
I
A
 
G
E
 
E
I
 
I
A
 
S
P
 
P
A
 
T
K
 
A
H
 
L
R
 
R
G
 
G
L
 
A
W
 
F
S
 
G
S
 
T
S
 
L
V
 
N
Y
x
Q
V
 
L
G
 
G
V
 
I
T
 
V
L
 
V
G
 
G
V
x
I
M
 
L
G
 
-
A
 
-
T
 
V
A
 
A
V
 
Q
A
 
I
A
 
F
A
 
G
L
 
L
T
 
E
W
 
F
L
 
I
L
 
L
G
 
G
T
 
S
Q
 
E

Sites not aligning to the query:

Query Sequence

>AO356_29600 FitnessBrowser__pseudo5_N2C3_1:AO356_29600
MNNSTSHQGRLRSLRAAAVGNALEWFDWTLYATFSVYLARNLFDKTDPRSAMLATLAVFA
AGFIARPLGGFFFGRLSDVLGRRAIMVITMMLLAASSLGIALIPNYQDIGLYASSALLVF
RLIQGLAHGGETGVSYTYVAEIAPAKHRGLWSSSVYVGVTLGVMGATAVAAALTWLLGTQ
ATGDYGWRIGFAIGGVLGIYALFLRRSAQESHVFEQQRQQAQPPRKLSKGEVLRMTRNIV
MLAAAANVTYYAWVTFGAASAIAQGMDATGAYLASLLAQVICVCWLPVCGMLSDRVGRKP
MVIAWGIGVVVLTYPISIIVTTEPYTLFLAQALALLAWASIAAIFPAVLSEQVPTQARAQ
SVGFVSSVSVAIFGGTAPYLHSYLVGAHLEYLYIGYLISLGLVTVAAGYFIEETAGIDLA
EIQAPGAGSAAL

Or try a new SitesBLAST search

SitesBLAST's Database

SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory