Comparing AO356_29640 FitnessBrowser__pseudo5_N2C3_1:AO356_29640 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
3sglA The crystal structure of mnmc from yersinia pestis bound with fad and sam (see paper)
29% identity, 54% coverage: 9:241/429 of query aligns to 211:430/630 of 3sglA
Sites not aligning to the query:
5i39A High resolution structure of l-amino acid deaminase from proteus vulgaris with the deletion of the specific insertion sequence (see paper)
24% identity, 82% coverage: 31:381/429 of query aligns to 23:351/383 of 5i39A
Sites not aligning to the query:
3pvcA Crystal structure of apo mnmc from yersinia pestis (see paper)
27% identity, 54% coverage: 9:241/429 of query aligns to 214:434/635 of 3pvcA
Sites not aligning to the query:
5hxwA L-amino acid deaminase from proteus vulgaris (see paper)
26% identity, 44% coverage: 31:218/429 of query aligns to 15:195/433 of 5hxwA
Sites not aligning to the query:
>AO356_29640 FitnessBrowser__pseudo5_N2C3_1:AO356_29640
MNAPFAPQLPASLWAATATPAVQTPALAEDKQVDVAIVGAGYTGLVTALRLAEAGVSVCV
LDTGEPGWGASGRNGGQVIPGLKFDPDQLLAKFGPARAEAMIEAAGSAADEVFALIRQYG
IECDATQKGWIQPACSTTAMKTIEQRAAQWQRRGVKVELLDRAAVSQRIGTENYLGGWVD
PRAGSLHPLSYARGLAKAAVGQGAMIHGHSRVTGLQRQRSGWLLSTAQGFKVSAQRVLLA
TDGYTDDLWPGLRQTVVAANSFIIATRPLPPAIRKTILPGGEVCSDSRRLLLYFKLDAQG
RLLLGGRGPFSEPSRQRDWAHLERSLGALFAQVAEVPVEYRWSGRVALTQSFLPHVHDPA
PGLSVLLGYNGRGIALSTALGKHLAAKLSGATQDFPFPVMPLRRIPFHALQRLYLAAGIS
YYRVLDALF
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory