Comparing AO356_29645 FitnessBrowser__pseudo5_N2C3_1:AO356_29645 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3c4jA Abc protein artp in complex with atp-gamma-s
54% identity, 97% coverage: 1:240/248 of query aligns to 3:242/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
54% identity, 97% coverage: 1:240/248 of query aligns to 3:242/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
54% identity, 97% coverage: 1:240/248 of query aligns to 3:242/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
54% identity, 97% coverage: 1:240/248 of query aligns to 3:242/242 of 2oljA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
55% identity, 97% coverage: 1:240/248 of query aligns to 1:240/240 of 4ymuJ
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
56% identity, 97% coverage: 1:241/248 of query aligns to 2:241/241 of 4u00A
P02915 Histidine/lysine/arginine/ornithine transport ATP-binding protein HisP; EC 7.4.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
53% identity, 93% coverage: 7:237/248 of query aligns to 12:254/258 of P02915
1b0uA Atp-binding subunit of the histidine permease from salmonella typhimurium (see paper)
53% identity, 93% coverage: 7:237/248 of query aligns to 8:250/258 of 1b0uA
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
37% identity, 96% coverage: 5:241/248 of query aligns to 9:246/343 of P30750
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
37% identity, 96% coverage: 5:241/248 of query aligns to 10:247/344 of 6cvlD
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
37% identity, 96% coverage: 5:241/248 of query aligns to 10:247/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
37% identity, 96% coverage: 5:241/248 of query aligns to 10:247/344 of 3tuiC
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
36% identity, 95% coverage: 1:236/248 of query aligns to 4:243/375 of 2d62A
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
35% identity, 98% coverage: 7:248/248 of query aligns to 32:274/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
35% identity, 98% coverage: 7:248/248 of query aligns to 32:274/382 of 7aheC
Sites not aligning to the query:
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
40% identity, 86% coverage: 1:214/248 of query aligns to 1:223/232 of 1f3oA
1g291 Malk (see paper)
36% identity, 93% coverage: 7:236/248 of query aligns to 9:240/372 of 1g291
Sites not aligning to the query:
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
39% identity, 90% coverage: 1:222/248 of query aligns to 4:229/648 of P75831
1l2tA Dimeric structure of mj0796, a bacterial abc transporter cassette (see paper)
40% identity, 86% coverage: 1:214/248 of query aligns to 1:223/230 of 1l2tA
1oxvD Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
34% identity, 99% coverage: 2:246/248 of query aligns to 4:251/353 of 1oxvD
>AO356_29645 FitnessBrowser__pseudo5_N2C3_1:AO356_29645
MIEIKGIHKRYGSVPVLEGIDLQVKSGEVVCLIGPSGSGKSTLLRCINGLESYDQGEVLV
GDERVDRNARNIHDIRTRVAMVFQRFNLFPHRTALENVMEGPIYVKKENPQAARKNAEAL
MEKVGLSHRMNAYPDELSGGQQQRVAIARALAMNPQAILFDEPTSALDPELVGEVLAVMR
NLANEGMTMIVVTHEMAFARDVADKVCFLHSGKIVESGPAGEVLSTPTHPRTQDFLRRLL
NHSGEVPA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory