Comparing AO356_29795 FitnessBrowser__pseudo5_N2C3_1:AO356_29795 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1b0uA Atp-binding subunit of the histidine permease from salmonella typhimurium (see paper)
57% identity, 90% coverage: 20:260/268 of query aligns to 8:250/258 of 1b0uA
P02915 Histidine/lysine/arginine/ornithine transport ATP-binding protein HisP; EC 7.4.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
57% identity, 90% coverage: 20:260/268 of query aligns to 12:254/258 of P02915
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
49% identity, 93% coverage: 15:262/268 of query aligns to 2:239/240 of 4ymuJ
3c4jA Abc protein artp in complex with atp-gamma-s
51% identity, 92% coverage: 15:261/268 of query aligns to 4:240/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
51% identity, 92% coverage: 15:261/268 of query aligns to 4:240/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
51% identity, 92% coverage: 15:261/268 of query aligns to 4:240/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
51% identity, 92% coverage: 15:261/268 of query aligns to 4:240/242 of 2oljA
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
50% identity, 92% coverage: 15:261/268 of query aligns to 3:238/241 of 4u00A
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
35% identity, 89% coverage: 10:248/268 of query aligns to 5:230/343 of P30750
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
35% identity, 89% coverage: 10:248/268 of query aligns to 6:231/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
35% identity, 89% coverage: 10:248/268 of query aligns to 6:231/344 of 3tuiC
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
35% identity, 89% coverage: 10:248/268 of query aligns to 6:231/344 of 6cvlD
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
38% identity, 82% coverage: 15:233/268 of query aligns to 4:217/226 of 5xu1B
8i6rB Cryo-em structure of pseudomonas aeruginosa ftse(e163q)x/envc complex with atp in peptidisc (see paper)
38% identity, 82% coverage: 19:239/268 of query aligns to 8:217/222 of 8i6rB
6z67B Ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution (see paper)
36% identity, 79% coverage: 30:242/268 of query aligns to 20:225/229 of 6z67B
Sites not aligning to the query:
6z4wA Ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) (see paper)
36% identity, 79% coverage: 30:242/268 of query aligns to 20:225/230 of 6z4wA
Sites not aligning to the query:
5ws4A Crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii (see paper)
39% identity, 79% coverage: 27:237/268 of query aligns to 21:221/650 of 5ws4A
2awnB Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
36% identity, 93% coverage: 14:262/268 of query aligns to 2:232/374 of 2awnB
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
36% identity, 93% coverage: 14:262/268 of query aligns to 2:232/371 of 3puyA
3puxA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 (see paper)
36% identity, 93% coverage: 14:262/268 of query aligns to 2:232/371 of 3puxA
>AO356_29795 FitnessBrowser__pseudo5_N2C3_1:AO356_29795
MSVAVNESSARATAIATQGLRKSYGEIEVLKGIDFTAREGEVVSILGASGSGKSTFLRCL
NLLELPSAGSLDVFGERVKLKQGASDAHIADRKQVDRLRTQVAMVFQNFCLWSHMTVLEN
LMEAPVHVQGRKKAEVRDEALSILERVGLTHRADAYPAQLSGGQQQRAAIARALVMKPRV
LLFDEPTSALDPELVGEVLKVMRDLATEGRTMLIVTHEMAFARDVSNRILFLDQGRIEAQ
GQPQQLFAGGVNERFDQFVRRFNESAAH
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory