Comparing AO356_29995 AO356_29995 3-hydroxybutyryl-CoA dehydrogenase to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4pzeA Crystal structure of (s)-3-hydroxybutyryl-coa dehydrogenase paah1 in complex with acetoacetyl-coa (see paper)
55% identity, 100% coverage: 2:282/282 of query aligns to 1:282/283 of 4pzeA
4pzdA Crystal structure of (s)-3-hydroxybutyryl-coa dehydrogenase paah1 in complex with NAD+ (see paper)
55% identity, 100% coverage: 2:282/282 of query aligns to 1:282/283 of 4pzdA
6aa8E Crystal structure of (s)-3-hydroxybutyryl-coenzymea dehydrogenase from clostridium acetobutylicum complexed with NAD+ (see paper)
47% identity, 99% coverage: 4:282/282 of query aligns to 1:280/281 of 6aa8E
4kugA Crystal structure of 3-hydroxybutylryl-coa dehydrogenase with NAD from clostridium butyricum
46% identity, 99% coverage: 3:282/282 of query aligns to 1:281/282 of 4kugA
4kuhA Crystal structure of 3-hydroxybutylryl-coa dehydrogenase with acetoacetyl-coa from clostridium butyricum
46% identity, 99% coverage: 3:281/282 of query aligns to 1:280/280 of 4kuhA
P00348 Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial; HCDH; L-3-hydroxyacyl CoA dehydrogenase; Medium and short-chain L-3-hydroxyacyl-coenzyme A dehydrogenase; Short-chain 3-hydroxyacyl-CoA dehydrogenase; EC 1.1.1.35 from Sus scrofa (Pig) (see paper)
40% identity, 99% coverage: 3:282/282 of query aligns to 27:314/314 of P00348
1f0yA L-3-hydroxyacyl-coa dehydrogenase complexed with acetoacetyl-coa and NAD+ (see paper)
40% identity, 99% coverage: 3:282/282 of query aligns to 4:291/291 of 1f0yA
1f17A L-3-hydroxyacyl-coa dehydrogenase complexed with nadh (see paper)
40% identity, 99% coverage: 3:282/282 of query aligns to 4:291/293 of 1f17A
1f12A L-3-hydroxyacyl-coa dehydrogenase complexed with 3-hydroxybutyryl-coa (see paper)
40% identity, 99% coverage: 3:282/282 of query aligns to 4:291/293 of 1f12A
Q16836 Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial; HCDH; Medium and short-chain L-3-hydroxyacyl-coenzyme A dehydrogenase; Short-chain 3-hydroxyacyl-CoA dehydrogenase; EC 1.1.1.35 from Homo sapiens (Human) (see 7 papers)
41% identity, 99% coverage: 3:282/282 of query aligns to 27:314/314 of Q16836
P9WNP7 3-hydroxybutyryl-CoA dehydrogenase; Beta-hydroxybutyryl-CoA dehydrogenase; BHBD; EC 1.1.1.157 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
39% identity, 99% coverage: 3:281/282 of query aligns to 5:286/286 of P9WNP7
P40939 Trifunctional enzyme subunit alpha, mitochondrial; 78 kDa gastrin-binding protein; Monolysocardiolipin acyltransferase; TP-alpha; EC 2.3.1.-; EC 4.2.1.17; EC 1.1.1.211 from Homo sapiens (Human) (see 5 papers)
38% identity, 99% coverage: 3:282/282 of query aligns to 361:640/763 of P40939
Sites not aligning to the query:
1wdlA Fatty acid beta-oxidation multienzyme complex from pseudomonas fragi, form ii (native4) (see paper)
38% identity, 92% coverage: 22:281/282 of query aligns to 333:592/715 of 1wdlA
Sites not aligning to the query:
P28793 Fatty acid oxidation complex subunit alpha; EC 4.2.1.17; EC 5.1.2.3; EC 5.3.3.8; EC 1.1.1.35 from Pseudomonas fragi (see paper)
38% identity, 92% coverage: 22:281/282 of query aligns to 333:592/715 of P28793
Sites not aligning to the query:
1wdmA Fatty acid beta-oxidation multienzyme complex from pseudomonas fragi, form i (native3) (see paper)
38% identity, 93% coverage: 22:282/282 of query aligns to 333:593/707 of 1wdmA
Sites not aligning to the query:
P21177 Fatty acid oxidation complex subunit alpha; EC 4.2.1.17; EC 5.1.2.3; EC 5.3.3.8; EC 1.1.1.35 from Escherichia coli (strain K12) (see 2 papers)
36% identity, 100% coverage: 2:282/282 of query aligns to 312:593/729 of P21177
Sites not aligning to the query:
6tnmA E. Coli aerobic trifunctional enzyme subunit-alpha (see paper)
36% identity, 100% coverage: 2:282/282 of query aligns to 312:593/719 of 6tnmA
Sites not aligning to the query:
6yswA E. Coli anaerobic trifunctional enzyme subunit-alpha in complex with coenzyme a
35% identity, 93% coverage: 21:281/282 of query aligns to 324:583/707 of 6yswA
Sites not aligning to the query:
6iunB Crystal structure of enoyl-coa hydratase (ech) from ralstonia eutropha h16 in complex with NAD
31% identity, 99% coverage: 3:282/282 of query aligns to 291:567/692 of 6iunB
Sites not aligning to the query:
8oqqA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-79
33% identity, 99% coverage: 3:281/282 of query aligns to 328:610/723 of 8oqqA
Sites not aligning to the query:
>AO356_29995 AO356_29995 3-hydroxybutyryl-CoA dehydrogenase
MTLQHIAVIGAGTMGSGIAQTCAAAGHTLLLIDIHEQALGRGLQIVQKNLDRQVEKGTLL
PAQAIETLQRIHTSTHYTDLDQMDVVIEAATEDLLLKRKILQQVDTHARLDCLIASNTSS
LSITQLAASIKHPERFMGIHFFNPVPIMGLVELIRGLQTSDATCSTAGALIEQLGKTAIH
TQNRPGFMVNRILIPMINEAIFVLQENGDAQAIDASMRLGCNQPIGPLALADLIGLDTVL
GILDNLQTGFGDPKYRPAPLLKEMVAAGLLGKKSGRGFHVYN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory