SitesBLAST
Comparing AO356_30165 FitnessBrowser__pseudo5_N2C3_1:AO356_30165 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 13 hits to proteins with known functional sites (download)
7cdyA Crystal structure of glucose dehydrogenase
50% identity, 95% coverage: 16:354/357 of query aligns to 5:343/346 of 7cdyA
7cgzA Glucose dehydrogenase
48% identity, 95% coverage: 16:354/357 of query aligns to 5:318/321 of 7cgzA
P75804 Aldose sugar dehydrogenase YliI; Asd; Soluble aldose sugar dehydrogenase YliI; EC 1.1.5.- from Escherichia coli (strain K12) (see paper)
45% identity, 99% coverage: 4:357/357 of query aligns to 17:370/371 of P75804
- Q82 (= Q68) binding
- E240 (= E227) binding
- Y250 (= Y237) binding
- Y261 (= Y248) binding
2g8sA Crystal structure of the soluble aldose sugar dehydrogenase (asd) from escherichia coli in the apo-form (see paper)
45% identity, 97% coverage: 10:357/357 of query aligns to 1:348/348 of 2g8sA
2ismB Crystal structure of the putative oxidoreductase (glucose dehydrogenase) (ttha0570) from thermus theromophilus hb8
34% identity, 95% coverage: 12:350/357 of query aligns to 2:319/333 of 2ismB
3a9hA Crystal structure of pqq-dependent sugar dehydrogenase holo-form (see paper)
33% identity, 95% coverage: 11:350/357 of query aligns to 3:320/338 of 3a9hA
- active site: H120 (= H134), D139 (≠ E153), R182 (= R202), T224 (= T243), K226 (= K252), G228 (= G254)
- binding calcium ion: E208 (= E227), Y218 (= Y237)
- binding alpha-D-glucopyranose: G228 (= G254), R229 (≠ D255), F232 (≠ T258), V233 (≠ A259), D234 (≠ K260)
- binding pyrroloquinoline quinone: E57 (≠ Q68), H120 (= H134), N183 (= N203), Q185 (= Q205), H201 (= H220), V204 (≠ Q223), T243 (≠ Y269), L269 (= L300), R270 (≠ K301), R298 (= R328), R300 (= R330), R320 (≠ K350)
3a9gA Crystal structure of pqq-dependent sugar dehydrogenase apo-form (see paper)
33% identity, 95% coverage: 11:350/357 of query aligns to 3:320/338 of 3a9gA
- active site: H120 (= H134), D139 (≠ E153), R182 (= R202), T224 (= T243), K226 (= K252), G228 (= G254)
- binding calcium ion: E208 (= E227), Y218 (= Y237)
- binding alpha-D-glucopyranose: R144 (≠ K158), D148 (≠ E163), G228 (= G254), R229 (≠ D255), F232 (≠ T258), V233 (≠ A259), D234 (≠ K260)
1cruA Soluble quinoprotein glucose dehydrogenase from acinetobacter calcoaceticus in complex with pqq and methylhydrazine (see paper)
28% identity, 96% coverage: 5:345/357 of query aligns to 10:422/448 of 1cruA
- active site: H142 (= H134), D161 (≠ E153), R226 (= R202), A267 (≠ I242), Y269 (= Y244), D271 (≠ E246), E307 (≠ G262)
- binding calcium ion: G245 (= G221), P246 (= P222), E251 (= E227), Y261 (= Y237), A267 (≠ I242), Y269 (= Y244), D271 (≠ E246), E307 (≠ G262)
- binding methylhydrazine: Y341 (vs. gap), W344 (vs. gap)
- binding pyrroloquinoline quinone: Q76 (= Q68), H142 (= H134), R226 (= R202), N227 (= N203), Q244 (≠ H220), Y341 (vs. gap), T346 (≠ S273), A348 (= A275), L374 (= L300), K375 (= K301), R404 (= R328), R406 (= R330)
3dasA Structure of the pqq-bound form of aldose sugar dehydrogenase (adh) from streptomyces coelicolor
29% identity, 94% coverage: 17:350/357 of query aligns to 14:318/334 of 3dasA
- active site: H127 (= H134), E146 (= E153), R189 (= R202), E230 (= E246), K232 (≠ Y248), G234 (= G250)
- binding alpha-L-arabinopyranose: K199 (≠ D212), D248 (≠ P272), R268 (≠ K301), G269 (≠ F302), E270 (≠ G303), K278 (= K311), G279 (≠ D312)
- binding calcium ion: G208 (= G221), Q209 (≠ P222), E214 (= E227), Y224 (= Y237)
- binding pyrroloquinoline quinone: E66 (≠ Q68), H127 (= H134), R189 (= R202), N190 (= N203), Q192 (= Q205), F207 (≠ H220), S251 (≠ A275), R268 (≠ K301), R296 (= R328), R298 (= R330), R318 (≠ K350)
5minB Apo form of the soluble pqq-dependent glucose dehydrogenase from acinetobacter calcoaceticus
28% identity, 96% coverage: 5:345/357 of query aligns to 10:424/453 of 5minB
- active site: H144 (= H134), D163 (≠ E153), R228 (= R202), A269 (≠ T243), Y271 (= Y244), D273 (≠ E246), E309 (≠ G262)
- binding calcium ion: E253 (= E227), Y263 (= Y237), A269 (≠ T243), Y271 (= Y244), D273 (≠ E246), E309 (≠ G262)
P13650 Quinoprotein glucose dehydrogenase B; Glucose dehydrogenase B [pyrroloquinoline-quinone]; Soluble glucose dehydrogenase; s-GDH; EC 1.1.5.2 from Acinetobacter calcoaceticus (see paper)
27% identity, 96% coverage: 5:345/357 of query aligns to 34:448/478 of P13650
- Q100 (= Q68) binding
- D167 (≠ A133) binding
- Q192 (vs. gap) binding
- R252 (= R202) binding
- G271 (= G221) binding
- P272 (= P222) binding
- E277 (= E227) binding
- Y287 (= Y237) binding
- A293 (≠ T243) binding
- Y295 (= Y244) binding
- D297 (≠ E246) binding
- E333 (vs. gap) binding
- Y367 (≠ L267) binding
- T372 (≠ S273) binding
- K401 (= K301) binding
1cq1A Soluble quinoprotein glucose dehydrogenase from acinetobacter calcoaceticus in complex with pqqh2 and glucose (see paper)
28% identity, 96% coverage: 5:345/357 of query aligns to 10:418/444 of 1cq1A
- active site: H138 (= H134), D157 (≠ E153), R222 (= R202), A263 (≠ I242), Y265 (= Y244), D267 (≠ E246), E303 (≠ G262)
- binding beta-D-glucopyranose: D137 (≠ A133), H138 (= H134), Q162 (vs. gap), Y337 (vs. gap)
- binding calcium ion: G241 (= G221), P242 (= P222), E247 (= E227), Y257 (= Y237), A263 (≠ I242), Y265 (= Y244), D267 (≠ E246), E303 (≠ G262)
- binding pyrroloquinoline quinone: Q76 (= Q68), H138 (= H134), R222 (= R202), N223 (= N203), Q240 (≠ H220), Y337 (vs. gap), T342 (≠ S273), A344 (= A275), L370 (= L300), K371 (= K301), R400 (= R328), R402 (= R330)
1c9uA Crystal structure of the soluble quinoprotein glucose dehydrogenase in complex with pqq (see paper)
28% identity, 96% coverage: 5:345/357 of query aligns to 10:418/444 of 1c9uA
- active site: H138 (= H134), D157 (≠ E153), R222 (= R202), A263 (≠ I242), Y265 (= Y244), D267 (≠ E246), E303 (≠ G262)
- binding calcium ion: R222 (= R202), G241 (= G221), P242 (= P222), E247 (= E227), Y257 (= Y237), A263 (≠ I242), Y265 (= Y244), D267 (≠ E246), E303 (≠ G262)
- binding pyrroloquinoline quinone: Q76 (= Q68), H138 (= H134), R222 (= R202), N223 (= N203), Q240 (≠ H220), Y337 (vs. gap), W340 (vs. gap), T342 (≠ S273), L370 (= L300), K371 (= K301), R400 (= R328), R402 (= R330)
Query Sequence
>AO356_30165 FitnessBrowser__pseudo5_N2C3_1:AO356_30165
MGFAASALAAEVRAERVATGLENPWAVAFLPAHRYLVTERPGRLRVVGADGSIGPPVEGL
PAIAAGGQGGLLDVVTDSAFDVNRMVYFCFSEPAAGGAGNSTAVARATLSSNMVRLDNLQ
VIFSQRPKVSSSAHFGCRIVEAKDGTLFVTLGERYSRKEDAQELDNHLGKVVRIQKDGVV
PTDNPFVGRPGALPEIWSYGHRNSQGATLGPDGRLWMNDHGPQGGDEINVPLAGRNYGWP
VITYGENYGGGKIGDGLTAKDGMEQPLHYWVPSIAPSGMAFLTSDRYGPAWKGNLFVGSL
KFGYLDRIELKDGKVVAEHKLLEDGHARVRDVRQGPDGLLYVLTDEQDGKLLRLQPR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory