SitesBLAST
Comparing AO356_30210 FitnessBrowser__pseudo5_N2C3_1:AO356_30210 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8gy3C Cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans
25% identity, 91% coverage: 58:745/752 of query aligns to 8:718/732 of 8gy3C
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): M38 (≠ G86), G39 (= G87), Q40 (= Q88), H41 (≠ G89), V42 (≠ I90), A45 (≠ G93), G79 (= G131), G80 (= G132), S81 (= S133), S83 (= S135), V84 (≠ M136), G374 (≠ F423), F375 (= F424), L379 (≠ F428), L499 (≠ W541), R500 (= R542), V624 (= V651), D625 (≠ N652), Q632 (= Q659), T687 (≠ G714), G688 (= G715), L689 (≠ I716), G690 (= G717), E691 (= E718)
3hrdE Crystal structure of nicotinate dehydrogenase (see paper)
24% identity, 48% coverage: 213:572/752 of query aligns to 4:380/420 of 3hrdE
- active site: Q207 (= Q393), L242 (≠ F428), R318 (≠ T510), H322 (≠ G514), R350 (= R542)
- binding calcium ion: T206 (≠ N392), N208 (≠ A394), D212 (≠ F398), K241 (≠ H427), L242 (≠ F428), D243 (≠ N432)
- binding pterin cytosine dinucleotide: G237 (≠ F423), F238 (= F424), R350 (= R542)
- binding selenium atom: F238 (= F424), A348 (≠ Y540), F349 (≠ W541), R350 (= R542)
3hrdA Crystal structure of nicotinate dehydrogenase (see paper)
24% identity, 48% coverage: 213:572/752 of query aligns to 4:380/420 of 3hrdA
- active site: Q207 (= Q393), L242 (≠ F428), R318 (≠ T510), H322 (≠ G514), R350 (= R542)
- binding pterin cytosine dinucleotide: G236 (= G422), G237 (≠ F423), F238 (= F424), R350 (= R542)
- binding magnesium ion: T206 (≠ N392), N208 (≠ A394), D212 (≠ F398), K241 (≠ H427), L242 (≠ F428), D243 (≠ N432), T305 (≠ E497), Y308 (≠ A500), A309 (≠ N501), S346 (≠ L538)
- binding nicotinic acid: A314 (≠ K506), R318 (≠ T510), F352 (≠ V544)
- binding selenium atom: F238 (= F424), G239 (= G425), A348 (≠ Y540), F349 (≠ W541), R350 (= R542)
Q0QLF2 Nicotinate dehydrogenase large molybdopterin subunit; NDH; Nicotinic acid hydroxylase large molybdopterin subunit; NAH; EC 1.17.1.5 from Eubacterium barkeri (Clostridium barkeri) (see 2 papers)
24% identity, 48% coverage: 213:572/752 of query aligns to 5:381/425 of Q0QLF2
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2:425 modified: mature protein, Nicotinate dehydrogenase large molybdopterin subunit
O33819 4-hydroxybenzoyl-CoA reductase subunit alpha; 4-HBCR subunit alpha; EC 1.1.7.1 from Thauera aromatica (see paper)
32% identity, 20% coverage: 598:750/752 of query aligns to 595:758/769 of O33819
- VGKALN 650:655 (≠ PGSIVN 647:652) binding
- KEAS 722:725 (vs. gap) binding
Sites not aligning to the query:
- 214 binding
- 244:245 binding
- 522:526 binding
1rm6A Structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica (see paper)
32% identity, 20% coverage: 598:750/752 of query aligns to 587:750/761 of 1rm6A
- active site: E718 (= E718), G719 (≠ P719)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): L646 (≠ V651), N647 (= N652), V651 (≠ I656), Q654 (= Q659), K714 (vs. gap), E715 (vs. gap), A716 (vs. gap), S717 (vs. gap), E718 (= E718)
Sites not aligning to the query:
- active site: 206, 241, 318, 322, 350
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 235, 236, 237, 238, 350, 473, 474, 475, 476, 513, 514, 515, 517, 518
1t3qB Crystal structure of quinoline 2-oxidoreductase from pseudomonas putida 86 (see paper)
23% identity, 48% coverage: 214:574/752 of query aligns to 12:403/786 of 1t3qB
Sites not aligning to the query:
- active site: 743, 744
- binding pterin cytosine dinucleotide: 506, 507, 508, 510, 513, 545, 547, 549, 550, 666, 670, 674, 675, 678, 739, 740, 741, 742
P19913 Carbon monoxide dehydrogenase large chain; CO dehydrogenase subunit L; CO-DH L; EC 1.2.5.3 from Hydrogenophaga pseudoflava (Pseudomonas carboxydoflava) (see paper)
28% identity, 31% coverage: 231:463/752 of query aligns to 33:310/803 of P19913
Sites not aligning to the query:
- 384 modified: 4-hydroxyarginine
1ffvB Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava (see paper)
28% identity, 31% coverage: 231:463/752 of query aligns to 27:304/797 of 1ffvB
Sites not aligning to the query:
- active site: 343, 349, 378, 379, 751, 752
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 376, 378, 379, 516, 517, 518, 520, 523, 556, 557, 558, 560, 561, 674, 678, 683, 686, 747, 748, 749, 750, 751
1ffuB Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor (see paper)
28% identity, 31% coverage: 231:463/752 of query aligns to 27:304/797 of 1ffuB
Sites not aligning to the query:
- active site: 343, 349, 378, 379, 751, 752
- binding cytidine-5'-diphosphate: 518, 520, 523, 558, 560, 561, 674, 676, 678, 683, 747, 748, 749, 750
5y6qC Crystal structure of an aldehyde oxidase from methylobacillus sp. Ky4400 (see paper)
24% identity, 31% coverage: 344:574/752 of query aligns to 156:376/748 of 5y6qC
Sites not aligning to the query:
- active site: 715, 716
- binding pterin cytosine dinucleotide: 461, 462, 463, 464, 468, 500, 502, 503, 504, 505, 638, 640, 641, 648, 711, 713, 714, 715
2e1qA Crystal structure of human xanthine oxidoreductase mutant, glu803val (see paper)
23% identity, 44% coverage: 256:585/752 of query aligns to 617:930/1307 of 2e1qA
- active site: Q742 (= Q393), V777 (≠ F428), R855 (≠ K502), H859 (≠ K506), R887 (= R542)
- binding bicarbonate ion: R814 (= R466), H815 (≠ P467), I852 (= I499), F886 (≠ W541), F889 (≠ V544), G890 (= G545), Q893 (≠ I548)
- binding calcium ion: E715 (≠ N367), H716 (= H368), Y718 (≠ Q370), T741 (≠ N392), T747 (≠ F398), S780 (≠ A433), T781 (≠ S434), S784 (≠ P437), T811 (≠ D463), G812 (≠ V464)
- binding fe2/s2 (inorganic) cluster: L719 (= L371)
- binding hydroxy(dioxo)molybdenum: F773 (= F424), G774 (= G425), R887 (= R542)
Sites not aligning to the query:
- active site: 1235, 1236
- binding flavin-adenine dinucleotide: 43, 44, 230, 231, 232, 233, 234, 235, 236, 237, 238, 311, 312, 316, 320, 321, 324, 325, 327, 328, 333, 334, 377, 378
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 71, 110, 111, 112, 114, 146, 148
- binding hydroxy(dioxo)molybdenum: 1053, 1054, 1236
2ckjA Human milk xanthine oxidoreductase
23% identity, 44% coverage: 256:585/752 of query aligns to 586:899/1264 of 2ckjA
Sites not aligning to the query:
- active site: 1204, 1205
- binding flavin-adenine dinucleotide: 228, 230, 231, 232, 233, 234, 308, 309, 317, 318, 321, 322, 324, 325, 331, 375
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 71, 111, 112, 114, 146, 147, 148
P47989 Xanthine dehydrogenase/oxidase; EC 1.17.1.4; EC 1.17.3.2 from Homo sapiens (Human) (see 4 papers)
23% identity, 44% coverage: 256:585/752 of query aligns to 643:956/1333 of P47989
- I646 (≠ V259) to V: in dbSNP:rs17323225
- I703 (≠ L330) to V: in dbSNP:rs17011368
- L763 (= L388) to F: in a breast cancer sample; somatic mutation
- R791 (≠ H416) to G: in a breast cancer sample; somatic mutation; dbSNP:rs775646772
- T910 (≠ Y540) to M: in dbSNP:rs669884
Sites not aligning to the query:
- 133 E → K: in dbSNP:rs45447191
- 172 G → R: in dbSNP:rs45523133
- 235 T → M: in dbSNP:rs45469499
- 257:264 binding
- 337 binding
- 347:351 binding
- 360 binding
- 395 K → M: in dbSNP:rs34929837
- 422 binding
- 509 modified: Disulfide link with 1318, In oxidase form
- 536 modified: Disulfide link with 993, In oxidase form
- 555 P → S: in dbSNP:rs45577338
- 584 D → A: in dbSNP:rs45491693
- 607 R → Q: in dbSNP:rs45442092
- 617 K → N: in dbSNP:rs45442398
- 623 T → I: in dbSNP:rs45448694
- 993 modified: Disulfide link with 536, In oxidase form
- 1091 V → L: in dbSNP:rs45619033
- 1109 N → T: in dbSNP:rs45547640
- 1150 P → R: in dbSNP:rs1042036
- 1176 R → C: in dbSNP:rs45624433
- 1296 R → W: in dbSNP:rs45564939
- 1318 modified: Disulfide link with 509, In oxidase form
1dgjA Crystal structure of the aldehyde oxidoreductase from desulfovibrio desulfuricans atcc 27774 (see paper)
27% identity, 29% coverage: 353:573/752 of query aligns to 351:566/906 of 1dgjA
Sites not aligning to the query:
- active site: 869, 870
- binding molybdenum (iv)oxide: 698, 869
- binding fe2/s2 (inorganic) cluster: 38, 39, 40, 41, 43, 44, 45, 46, 48, 58, 60, 100, 101, 103, 137, 139
- binding pterin cytosine dinucleotide: 99, 139, 652, 655, 656, 657, 658, 697, 698, 700, 702, 703, 799, 800, 803, 804, 807, 865, 866, 867, 868, 869
6a7xB Rat xanthine oxidoreductase, d428a variant, NAD bound form
26% identity, 28% coverage: 285:494/752 of query aligns to 640:838/1291 of 6a7xB
Sites not aligning to the query:
- active site: 851, 855, 883, 1231, 1232
- binding bicarbonate ion: 880, 881, 885, 886, 889
- binding flavin-adenine dinucleotide: 44, 227, 228, 229, 230, 231, 232, 233, 234, 307, 312, 317, 320, 321, 323, 324, 330, 373, 374
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 69, 71, 109, 110, 111, 113, 145, 147
- binding nicotinamide-adenine-dinucleotide: 327, 363, 364, 428, 430, 431, 471, 478
- binding uric acid: 851, 885, 980, 981, 1049, 1050, 1232
2e3tA Crystal structure of rat xanthine oxidoreductase mutant (w335a and f336l) (see paper)
26% identity, 28% coverage: 285:494/752 of query aligns to 642:840/1291 of 2e3tA
Sites not aligning to the query:
- active site: 853, 857, 885, 1233, 1234
- binding bicarbonate ion: 850, 882, 883, 887, 888, 891
- binding calcium ion: 843, 844, 847, 880, 881
- binding flavin-adenine dinucleotide: 44, 228, 229, 230, 231, 232, 233, 234, 235, 236, 309, 318, 319, 322, 323, 325, 326, 331, 332, 375, 376
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 69, 71, 109, 110, 113, 145, 147
- binding uric acid: 853, 887, 982, 983, 1051, 1052, 1234
4yswA Structure of rat xanthine oxidoreductase, c-terminal deletion protein variant, nadh bound form (see paper)
26% identity, 28% coverage: 285:494/752 of query aligns to 640:838/1286 of 4yswA
Sites not aligning to the query:
- active site: 851, 855, 883, 1231, 1232
- binding bicarbonate ion: 848, 880, 881, 882, 885, 886, 889
- binding calcium ion: 841, 842, 845, 878, 879
- binding flavin-adenine dinucleotide: 44, 226, 227, 228, 229, 230, 231, 232, 233, 234, 307, 308, 312, 316, 317, 320, 321, 323, 324, 329, 330, 373, 374, 399
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 71, 110, 111, 113, 145, 147
- binding 1,4-dihydronicotinamide adenine dinucleotide: 233, 326, 327, 328, 363, 364, 400, 401, 428, 430, 431, 471, 478, 1196
- binding uric acid: 851, 885, 980, 981, 1050, 1232
6a7xA Rat xanthine oxidoreductase, d428a variant, NAD bound form
26% identity, 28% coverage: 285:494/752 of query aligns to 642:840/1295 of 6a7xA
Sites not aligning to the query:
- active site: 853, 857, 885, 1233, 1234
- binding bicarbonate ion: 850, 883, 884, 887, 888, 891
- binding flavin-adenine dinucleotide: 44, 228, 229, 230, 231, 232, 233, 234, 235, 236, 309, 314, 319, 322, 323, 325, 326, 332, 376
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 69, 71, 109, 110, 111, 113, 145, 147
- binding nicotinamide-adenine-dinucleotide: 329, 365, 366, 432, 433, 473, 480
- binding uric acid: 853, 887, 982, 983, 1052, 1234
4zohA Crystal structure of glyceraldehyde oxidoreductase (see paper)
24% identity, 48% coverage: 215:574/752 of query aligns to 2:364/701 of 4zohA
Sites not aligning to the query:
- active site: 668, 669
- binding pterin cytosine dinucleotide: 442, 443, 444, 446, 482, 484, 486, 487, 594, 595, 598, 602, 664, 665, 666, 667, 668
Query Sequence
>AO356_30210 FitnessBrowser__pseudo5_N2C3_1:AO356_30210
MSKLDDSIAERGVLSDAQPVNVSRRRFLQASAGVTAGALVISFGIPLGPLRAAERAQALP
PGARVPAFLEIRPDNTVRLQSPFIEGGQGIFTGMAQVVGEELDIDPASFLVENAAPGNDF
KVMEGGMRFTGGSRSMRASYMTMRRLGASARLMLLQAASSHWKVPLAQLTTEPGRVIHAA
SNRSITYGELAPLTLDLPIPDPQTVTLRDPATFRWIGKPVQRIDVYDKSTGKAQYTIDTR
VEGMLHAAVQHAPRLGLQVGLVRNEDQIRNLKGVHSVHRLEGAVAVVAQRWWVAKRAVEA
LQVEWTEPGGDSTVRYMPANFDTQAYAEQLSKTTDAGDEAEREGDLQQGLAGAKKVVSAT
YHTQYLNHAQLEPPSALARFDAEGNLDLWLPNQAPDLFLADVAKRTGLDPSKITLHSPLL
GGFFGRHFLYPNASPYPQAIQLAQSTGRPIKVIWSREEEFLRDVLRPSAVVRFRAGLDEQ
GMPVAFEAISATEGPTEGIANKQGDKIDPTAVEGLAGKKYAIAHRRIAQLYSQTPVMLGY
WRSVGNSINDFMYEAFLDEVADAGGQDPYELRAKLLQGNERLSHLLKVVADLSGGWKRGP
FTAQDGTKRARGVAMASPFGTETAVIAEVSISNGAVKVHDIWQAIDPGSIVNPAIIEAQV
NSAVALGLSQTLVEQAIYKGGTPVARNYDLYRILTPEMMARVHVRVVESGAPMGGIGEPP
LPAVAPAVANAVSRLTGQRIRSMPLSQYRFDT
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory