SitesBLAST
Comparing AO356_30295 AO356_30295 fatty-acid oxidation protein subunit alpha to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6iunB Crystal structure of enoyl-coa hydratase (ech) from ralstonia eutropha h16 in complex with NAD
42% identity, 97% coverage: 9:693/703 of query aligns to 4:687/692 of 6iunB
- active site: A60 (= A65), F65 (= F70), E73 (vs. gap), H77 (≠ S79), G101 (= G103), E104 (= E106), E124 (= E126), G132 (= G134), K248 (≠ E255), S407 (= S414), H428 (= H435), E440 (= E447), N478 (= N485)
- binding nicotinamide-adenine-dinucleotide: G300 (= G307), T301 (= T308), M302 (= M309), E321 (= E328), T322 (≠ A329), Y365 (= Y372), A377 (= A384), V378 (= V385), E380 (= E387), V384 (≠ L391), V388 (= V395), N405 (= N412), S407 (= S414)
Q08426 Peroxisomal bifunctional enzyme; PBE; PBFE; L-bifunctional protein; LBP; Multifunctional enzyme 1; MFE1; EC 4.2.1.17; EC 5.3.3.8; EC 1.1.1.35 from Homo sapiens (Human) (see 5 papers)
38% identity, 99% coverage: 6:702/703 of query aligns to 1:715/723 of Q08426
- E3 (≠ S8) to K: in FRTS3; the mutant is mistargeted to mitochondria; results in impaired mitochondrial oxidative phosphorylation and defects in the transport of fluids across the epithelium of renal proximal tubular cells; dbSNP:rs398124646
- V40 (≠ N44) to G: in dbSNP:rs1062551
- I41 (≠ A45) to R: in dbSNP:rs1062552
- T75 (≠ S79) to I: in dbSNP:rs1062553
- K165 (≠ Q167) modified: N6-acetyllysine; alternate; mutation to Q: Greatly reduced acetylation and insensitive to treatment with TSA and NAM; when associated with Q-171; Q-346 and Q-584.
- K171 (≠ Q173) modified: N6-acetyllysine; mutation to Q: Greatly reduced acetylation and insensitive to treatment with TSA and NAM; when associated with Q-165; Q-346 and Q-584.
- A274 (= A279) to T: in dbSNP:rs2302819
- A325 (≠ L326) to G: in dbSNP:rs1062555
- K346 (≠ V347) modified: N6-acetyllysine; mutation to Q: Greatly reduced acetylation and insensitive to treatment with TSA and NAM; when associated with Q-165; Q-171 and Q-584.
- K584 (≠ E575) modified: N6-acetyllysine; alternate; mutation to Q: Greatly reduced acetylation and insensitive to treatment with TSA and NAM; when associated with Q-165; Q-171 and Q-346.
- K598 (≠ R588) to T: in dbSNP:rs1042437
- T606 (≠ E596) to P: in dbSNP:rs1042438
5omoA Crystal structure of rat peroxisomal multifunctional enzyme type-1 (rpmfe1) complexed with with 3s-hydroxy-decanoyl-coa and 3-keto- decanoyl-coa
39% identity, 94% coverage: 15:675/703 of query aligns to 16:689/725 of 5omoA
- active site: A66 (= A65), F71 (= F70), G81 (≠ A83), G105 (= G103), E108 (= E106), P127 (= P125), E128 (= E126), P135 (= P133), G136 (= G134), K254 (≠ E255), S415 (= S414), H436 (= H435), E448 (= E447), N486 (= N485)
- binding (s)-3-hydroxydecanoyl-coa: P25 (= P24), V26 (= V25), A28 (= A27), P31 (= P30), A64 (= A63), A66 (= A65), D67 (= D66), I68 (= I67), L103 (= L101), G105 (= G103), E108 (= E106), P127 (= P125), E128 (= E126), Y161 (≠ H159), F260 (= F261), K280 (≠ R281)
- binding 3-keto-decanoyl-coa: S415 (= S414), N486 (= N485), K519 (≠ P518), M520 (= M519), V525 (= V524), Y658 (≠ F644)
5mgbA Crystal structure of rat peroxisomal multifunctional enzyme type-1 (rpmfe1) complexed with acetoacetyl-coa and NAD (see paper)
39% identity, 94% coverage: 15:675/703 of query aligns to 16:689/725 of 5mgbA
- active site: A66 (= A65), F71 (= F70), G81 (≠ A83), G105 (= G103), E108 (= E106), P127 (= P125), E128 (= E126), P135 (= P133), G136 (= G134), K254 (≠ E255), S415 (= S414), H436 (= H435), E448 (= E447), N486 (= N485)
- binding acetoacetyl-coenzyme a: P25 (= P24), V26 (= V25), A64 (= A63), G65 (= G64), A66 (= A65), D67 (= D66), I68 (= I67), G105 (= G103), E128 (= E126), Y161 (≠ H159)
- binding nicotinamide-adenine-dinucleotide: L307 (≠ I304), G308 (= G305), G310 (= G307), T311 (= T308), M312 (= M309), E331 (= E328), S332 (≠ A329), Q336 (≠ A333), V386 (= V385), F387 (= F386), E388 (= E387), N413 (= N412), S415 (= S414), H436 (= H435)
3zwcA Crystal structure of rat peroxisomal multifunctional enzyme type 1 (rpmfe1) complexed with 3s-hydroxy-decanoyl-coa (see paper)
39% identity, 94% coverage: 15:675/703 of query aligns to 16:689/725 of 3zwcA
- active site: A66 (= A65), F71 (= F70), G81 (≠ A83), G105 (= G103), E108 (= E106), P127 (= P125), E128 (= E126), P135 (= P133), G136 (= G134), K254 (≠ E255), S415 (= S414), H436 (= H435), E448 (= E447), N486 (= N485)
- binding (s)-3-hydroxydecanoyl-coa: V26 (= V25), A64 (= A63), G65 (= G64), A66 (= A65), D67 (= D66), I68 (= I67), G77 (≠ S79), L78 (≠ M80), L80 (≠ A82), V101 (≠ Y99), G104 (= G102), G105 (= G103), E108 (= E106), E128 (= E126), F260 (= F261)
- binding nicotinamide-adenine-dinucleotide: G308 (= G305), G310 (= G307), T311 (= T308), M312 (= M309), E331 (= E328), Q336 (≠ A333), A385 (= A384), V386 (= V385), F387 (= F386), E388 (= E387), K393 (= K392), N413 (= N412), S415 (= S414), H436 (= H435)
2x58A The crystal structure of mfe1 liganded with coa (see paper)
39% identity, 94% coverage: 15:675/703 of query aligns to 16:689/725 of 2x58A
- active site: A66 (= A65), F71 (= F70), G81 (≠ A83), G105 (= G103), E108 (= E106), P127 (= P125), E128 (= E126), P135 (= P133), G136 (= G134), K254 (≠ E255), S415 (= S414), H436 (= H435), E448 (= E447), N486 (= N485)
- binding adenosine-5'-diphosphate: G310 (= G307), T311 (= T308), M312 (= M309), E331 (= E328), S332 (≠ A329), Q336 (≠ A333), V386 (= V385), L392 (= L391)
- binding coenzyme a: V26 (= V25), A28 (= A27), A64 (= A63), A66 (= A65), D67 (= D66), I68 (= I67), E128 (= E126)
6zibAAA structure of rat peroxisomal multifunctional enzyme type-1 (rpmfe1) complexed with acetoacetyl-coa and nadh'
39% identity, 94% coverage: 15:675/703 of query aligns to 16:687/723 of 6zibAAA
- active site: A66 (= A65), F71 (= F70), G81 (≠ A83), G105 (= G103), E108 (= E106), P127 (= P125), E128 (= E126), G136 (= G134), K254 (≠ E255), S413 (= S414), H434 (= H435), E446 (= E447), N484 (= N485)
- binding acetoacetyl-coenzyme a: P25 (= P24), V26 (= V25), A64 (= A63), G65 (= G64), A66 (= A65), D67 (= D66), I68 (= I67), G104 (= G102), G105 (= G103), E128 (= E126), Y161 (≠ H159)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G310 (= G307), T311 (= T308), M312 (= M309), E331 (= E328), S332 (≠ A329), Q336 (≠ A333), A383 (= A384), V384 (= V385), F385 (= F386), E386 (= E387), N411 (= N412), H434 (= H435)
3zw9A Crystal structure of rat peroxisomal multifunctional enzyme type 1 (rpmfe1) complexed with (2s,3s)-3-hydroxy-2- methylbutanoyl-coa (see paper)
39% identity, 94% coverage: 15:675/703 of query aligns to 14:687/723 of 3zw9A
- active site: A64 (= A65), F69 (= F70), G79 (≠ A83), G103 (= G103), E106 (= E106), P125 (= P125), E126 (= E126), P133 (= P133), G134 (= G134), K252 (≠ E255), S413 (= S414), H434 (= H435), E446 (= E447), N484 (= N485)
- binding nicotinamide-adenine-dinucleotide: L305 (≠ I304), G306 (= G305), G308 (= G307), T309 (= T308), M310 (= M309), E329 (= E328), Q334 (≠ A333), A383 (= A384), V384 (= V385), F385 (= F386), E386 (= E387), N411 (= N412), S413 (= S414), H434 (= H435)
- binding (2s,3s)-3-hydroxy-2-methylbutanoyl-coa: V24 (= V25), A62 (= A63), G63 (= G64), A64 (= A65), I66 (= I67), G102 (= G102), G103 (= G103), E106 (= E106), E126 (= E126), P133 (= P133), Y159 (≠ H159)
3zwaA Crystal structure of rat peroxisomal multifunctional enzyme type 1 (rpmfe1) complexed with 3s-hydroxy-hexanoyl-coa (see paper)
39% identity, 94% coverage: 15:675/703 of query aligns to 17:690/727 of 3zwaA
- active site: A67 (= A65), F72 (= F70), G82 (≠ A83), G106 (= G103), E109 (= E106), P128 (= P125), E129 (= E126), P136 (= P133), G137 (= G134), K255 (≠ E255), S416 (= S414), H437 (= H435), E449 (= E447), N487 (= N485)
- binding (S)-3-Hydroxyhexanoyl-CoA: V27 (= V25), A65 (= A63), G66 (= G64), A67 (= A65), D68 (= D66), I69 (= I67), L104 (= L101), E109 (= E106), R124 (≠ K121), E129 (= E126), L132 (= L129), G137 (= G134), Y162 (≠ H159)
6zicAAA structure of rat peroxisomal multifunctional enzyme type-1 (rpmfe1) complexed with 3s-hydroxybutanoyl-coa and nadh'
38% identity, 94% coverage: 15:675/703 of query aligns to 16:687/723 of 6zicAAA
- active site: A66 (= A65), F71 (= F70), G81 (≠ A83), G105 (= G103), E108 (= E106), P127 (= P125), E128 (= E126), G136 (= G134), K254 (≠ E255), S413 (= S414), H434 (= H435), E446 (= E447), N484 (= N485)
- binding 3-hydroxybutanoyl-coenzyme a: P25 (= P24), V26 (= V25), A28 (= A27), A66 (= A65), D67 (= D66), I68 (= I67), G104 (= G102), G105 (= G103), E108 (= E106), E128 (= E126), Y161 (≠ H159)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G308 (= G305), G310 (= G307), T311 (= T308), M312 (= M309), E331 (= E328), S332 (≠ A329), Q336 (≠ A333), A383 (= A384), V384 (= V385), F385 (= F386), E386 (= E387), L390 (= L391), K391 (= K392), N411 (= N412), S413 (= S414), H434 (= H435)
3zwbA Crystal structure of rat peroxisomal multifunctional enzyme type 1 (rpmfe1) complexed with 2trans-hexenoyl-coa (see paper)
39% identity, 94% coverage: 15:675/703 of query aligns to 16:689/725 of 3zwbA
- active site: A66 (= A65), G81 (≠ A83), G105 (= G103), E108 (= E106), P127 (= P125), A128 (≠ E126), P135 (= P133), G136 (= G134), S415 (= S414), H436 (= H435), E448 (= E447), N486 (= N485)
- binding (2E)-Hexenoyl-CoA: P25 (= P24), V26 (= V25), A28 (= A27), A64 (= A63), G65 (= G64), A66 (= A65), D67 (= D66), I68 (= I67), V101 (≠ Y99), L103 (= L101), G105 (= G103), E108 (= E106), G136 (= G134), Y161 (≠ H159), K280 (≠ R281)
6z5oAAA Peroxisomal bifunctional enzyme (see paper)
39% identity, 94% coverage: 15:675/703 of query aligns to 17:683/716 of 6z5oAAA
- active site: A67 (= A65), F72 (= F70), G82 (≠ A83), G106 (= G103), E109 (= E106), P128 (= P125), E129 (= E126), G137 (= G134), K255 (≠ E255), S409 (= S414), H430 (= H435), E442 (= E447), N480 (= N485)
- binding coenzyme a: P26 (= P24), V27 (= V25), A65 (= A63), D68 (= D66), I69 (= I67), P128 (= P125), Y162 (≠ H159), F277 (= F277), K281 (≠ R281)
- binding nicotinamide-adenine-dinucleotide: G309 (= G305), G311 (= G307), T312 (= T308), M313 (= M309), E332 (= E328), S333 (≠ A329), Q337 (≠ A333), A379 (= A384), V380 (= V385), F381 (= F386), E382 (= E387), K387 (= K392), N407 (= N412), S409 (= S414), H430 (= H435)
- binding nicotinamide: A67 (= A65), E109 (= E106), E129 (= E126), P136 (= P133), F261 (= F261)
P40939 Trifunctional enzyme subunit alpha, mitochondrial; 78 kDa gastrin-binding protein; Monolysocardiolipin acyltransferase; TP-alpha; EC 2.3.1.-; EC 4.2.1.17; EC 1.1.1.211 from Homo sapiens (Human) (see 5 papers)
32% identity, 97% coverage: 7:691/703 of query aligns to 41:755/763 of P40939
- V282 (≠ A220) to D: in MTPD1; mild phenotype with slowly progressive myopathy and sensorimotor polyneuropathy; dbSNP:rs137852773
- I305 (= I239) to N: in MTPD1; mild phenotype with slowly progressive myopathy and sensorimotor polyneuropathy; dbSNP:rs137852774
- L342 (≠ A276) to P: in LCHAD deficiency; dbSNP:rs137852772
- E510 (= E447) active site, For hydroxyacyl-coenzyme A dehydrogenase activity; to Q: in AFLP and LCHAD deficiency; loss of long-chain-3-hydroxyacyl-CoA dehydrogenase activity; dbSNP:rs137852769
6tnmA E. Coli aerobic trifunctional enzyme subunit-alpha (see paper)
30% identity, 98% coverage: 3:689/703 of query aligns to 6:707/719 of 6tnmA
- active site: A68 (= A65), F73 (= F70), G116 (= G103), E119 (= E106), P138 (= P125), E139 (= E126), G147 (= G134), N271 (≠ E255), S429 (= S414), H450 (= H435), E462 (= E447), N500 (= N485)
- binding adenosine-5'-triphosphate: D343 (≠ E328), I344 (≠ A329), V400 (= V385), V401 (≠ F386), V406 (≠ L391), K584 (= K565)
P21177 Fatty acid oxidation complex subunit alpha; EC 4.2.1.17; EC 5.1.2.3; EC 5.3.3.8; EC 1.1.1.35 from Escherichia coli (strain K12) (see 2 papers)
30% identity, 98% coverage: 3:689/703 of query aligns to 6:707/729 of P21177
- G116 (= G103) mutation to F: Absence of both enoyl-CoA hydratase and 3-hydroxyacyl-CoA epimerase activities. Delta(3)-cis-Delta(2)-trans-enoyl-CoA isomerase is only slightly affected.
- G322 (= G307) mutation to A: 10-fold increase in KM for NADH.
- H450 (= H435) active site, For 3-hydroxyacyl-CoA dehydrogenase activity; mutation H->A,Q: Almost complete loss of 3-hydroxyacyl-CoA dehydrogenase activity.
6yswA E. Coli anaerobic trifunctional enzyme subunit-alpha in complex with coenzyme a
30% identity, 97% coverage: 15:696/703 of query aligns to 13:702/707 of 6yswA
- active site: A66 (= A65), I71 (≠ F70), A84 (vs. gap), Q88 (vs. gap), G112 (= G103), E115 (= E106), P136 (= P125), E137 (= E126), G145 (= G134), D264 (≠ E255), S422 (= S414), H443 (= H435), E455 (= E447), N493 (= N485)
- binding coenzyme a: E23 (vs. gap), M25 (≠ V25), A66 (= A65), D67 (= D66), I68 (= I67), P136 (= P125), E137 (= E126), L140 (= L129), T290 (≠ R281), K293 (≠ A284)
1wdlA Fatty acid beta-oxidation multienzyme complex from pseudomonas fragi, form ii (native4) (see paper)
33% identity, 96% coverage: 25:696/703 of query aligns to 29:713/715 of 1wdlA
- active site: A69 (= A65), N89 (≠ S79), N93 (≠ A83), G117 (= G103), E120 (= E106), P139 (= P125), E140 (= E126), P147 (= P133), G148 (= G134), S430 (= S414), H451 (= H435), E463 (= E447), N501 (= N485)
- binding nicotinamide-adenine-dinucleotide: A322 (= A306), I324 (≠ T308), M325 (= M309), D344 (≠ E328), I345 (≠ A329), A400 (= A384), V401 (= V385), E403 (= E387), N428 (= N412), T429 (≠ S413), S430 (= S414)
P28793 Fatty acid oxidation complex subunit alpha; EC 4.2.1.17; EC 5.1.2.3; EC 5.3.3.8; EC 1.1.1.35 from Pseudomonas fragi (see paper)
33% identity, 96% coverage: 25:696/703 of query aligns to 29:713/715 of P28793
1wdmA Fatty acid beta-oxidation multienzyme complex from pseudomonas fragi, form i (native3) (see paper)
33% identity, 94% coverage: 39:696/703 of query aligns to 43:705/707 of 1wdmA
- active site: A69 (= A65), N89 (≠ S79), N93 (≠ A83), G117 (= G103), E120 (= E106), P139 (= P125), E140 (= E126), P147 (= P133), G148 (= G134), S430 (= S414), H451 (= H435), E463 (= E447), N501 (= N485)
- binding acetyl coenzyme *a: K142 (≠ A128), D297 (≠ E280), M459 (= M443), N501 (= N485), P534 (= P518), Y652 (= Y642), L658 (≠ R648)
- binding nicotinamide-adenine-dinucleotide: G321 (= G305), A322 (= A306), I324 (≠ T308), M325 (= M309), D344 (≠ E328), V401 (= V385), E403 (= E387), N428 (= N412), S430 (= S414), N454 (≠ A438)
7o4uA Structure of the alpha subunit of mycobacterium tuberculosis beta- oxidation trifunctional enzyme in complex with oxidized nicotinamide adenine dinucleotide (see paper)
32% identity, 91% coverage: 10:652/703 of query aligns to 9:669/711 of 7o4uA
Query Sequence
>AO356_30295 AO356_30295 fatty-acid oxidation protein subunit alpha
MSESLMVSYEVEGVVAVITVNNPPVNALTPEMRGSIIDAVTHANADPAVAAIVLMGGGQN
FIAGADIRQFGKARTITTSMSAAALDASAKPTVAAIHGYALGGGLEHALACHYRIALPTA
KLGLPEVALGLIPGGGGTQRLPRLVGAAVATDLLVSSRHIHAPEALQIGLISQIVPGTQN
QELRDAAVRYAKAVAHAQPQRVRDLALEPMDATTMDLLQAARREAAKKSPHNKAPQYAID
CIEAAFNLPFDEALEVESRLFSELEGSDVAKALRYAFFAEREAAKVPDAPPGFKPAGVTS
AAVIGAGTMGAGIAICFADAGIVVKLLEASAEALDRGLQRIRDIYAVKVKRGRMTVQEMD
ACLQFVQPVSHYEEIGDCDVVVEAVFERIDLKKDVFTKLDAVMKPGALLLTNSSAIDINV
MANMTGRPQSVAGAHFFAPANAMKLCEIVKGDQTSIETVVRAMKMGRDLKKVCAVSGTCD
GFAANRSRAPLVTEMMLLLEEGARPEQIDRVMVEFGYPMGPFAVSDLSGLDVSYDTRKRR
AAADPQYRKLHVPDRMVELGRKGQKNGAGWYRYEEGDRTPRHDEEVMRIIATVAHELGTP
QRTFTDSEILKRLLFASINEACKILDEGKAYRASDIDVMWLYGFGFPRHRGGLLYWADTI
GATEIHLQVQQWHEQYGRRWAPSPLLSKAANEGLSLRELKSVI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory