SitesBLAST
Comparing AO356_30330 FitnessBrowser__pseudo5_N2C3_1:AO356_30330 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3w6zA Crystal structure of NADP bound l-serine 3-dehydrogenase (k170m) from hyperthermophilic archaeon pyrobaculum calidifontis (see paper)
32% identity, 61% coverage: 1:271/444 of query aligns to 14:289/296 of 3w6zA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G20 (= G7), L21 (= L8), G22 (= G9), I23 (≠ A10), M24 (≠ L11), N43 (≠ D28), R44 (≠ I29), T45 (≠ N30), K48 (≠ A33), V77 (≠ L62), S78 (≠ P63), D82 (= D67), Q85 (≠ S70), V133 (= V118), F244 (= F230), K245 (≠ A231), H248 (≠ L234), K251 (= K237)
3ws7A The 1.18 a resolution structure of l-serine 3-dehydrogenase complexed with NADP+ and sulfate ion from the hyperthermophilic archaeon pyrobaculum calidifontis (see paper)
32% identity, 61% coverage: 1:271/444 of query aligns to 14:286/293 of 3ws7A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G20 (= G7), L21 (= L8), G22 (= G9), I23 (≠ A10), M24 (≠ L11), N43 (≠ D28), R44 (≠ I29), T45 (≠ N30), K48 (≠ A33), M76 (≠ C61), V77 (≠ L62), S78 (≠ P63), D82 (= D67), Q85 (≠ S70), V133 (= V118), F241 (= F230), K242 (≠ A231), H245 (≠ L234), K248 (= K237)
- binding sulfate ion: T134 (≠ S119), G135 (≠ A120), K183 (= K169)
2i9pB Crystal structure of human hydroxyisobutyrate dehydrogenase complexed with NAD+
31% identity, 60% coverage: 1:265/444 of query aligns to 1:273/296 of 2i9pB
- binding nicotinamide-adenine-dinucleotide: G9 (= G9), N10 (≠ A10), M11 (≠ L11), Y29 (≠ W27), D30 (= D28), V31 (≠ I29), M63 (≠ C61), L64 (= L62), P65 (= P63), T95 (≠ S93), V120 (= V118), G122 (≠ A120), F238 (= F230), K245 (= K237)
P29266 3-hydroxyisobutyrate dehydrogenase, mitochondrial; HIBADH; EC 1.1.1.31 from Rattus norvegicus (Rat) (see paper)
30% identity, 59% coverage: 3:265/444 of query aligns to 41:311/335 of P29266
- D68 (= D28) mutation to R: Decrease of activity with NAD, increase of activity with NADP.
- K208 (= K169) mutation K->A,H,N,R: Complete loss of activity.
- N212 (= N173) mutation to Q: Decrease in activity.
P31937 3-hydroxyisobutyrate dehydrogenase, mitochondrial; HIBADH; EC 1.1.1.31 from Homo sapiens (Human) (see paper)
31% identity, 59% coverage: 3:265/444 of query aligns to 42:312/336 of P31937
- LP 103:104 (= LP 62:63) binding
- N108 (≠ D67) binding
- T134 (≠ S93) binding
- K284 (= K237) binding
Sites not aligning to the query:
- 1:36 modified: transit peptide, Mitochondrion
- 40:68 binding
1wp4A Structure of tt368 protein from thermus thermophilus hb8 (see paper)
31% identity, 65% coverage: 2:291/444 of query aligns to 2:287/288 of 1wp4A
- active site: S116 (= S119), K164 (= K169), N167 (= N172), N168 (= N173)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G7 (= G7), L8 (= L8), G9 (= G9), A10 (= A10), M11 (≠ L11), N29 (≠ D28), R30 (≠ I29), T31 (≠ N30), K34 (≠ A32), C61 (= C61), L62 (= L62), P63 (= P63), E67 (≠ D67), S90 (= S93), V115 (= V118), T225 (= T228), F226 (= F230), K233 (= K237)
- binding sulfate ion: S116 (= S119), G117 (≠ A120), G118 (≠ S121), K164 (= K169)
2cvzC Structure of hydroxyisobutyrate dehydrogenase from thermus thermophilus hb8 (see paper)
31% identity, 65% coverage: 2:291/444 of query aligns to 3:288/289 of 2cvzC
- active site: S117 (= S119), K165 (= K169), N168 (= N172), N169 (= N173)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G7), L9 (= L8), G10 (= G9), A11 (= A10), M12 (≠ L11), N30 (≠ D28), R31 (≠ I29), T32 (≠ N30), C62 (= C61), L63 (= L62), P64 (= P63), E68 (≠ D67), E71 (≠ S70), S91 (= S93), V116 (= V118), F227 (= F230), K234 (= K237)
5je8B The crystal structure of bacillus cereus 3-hydroxyisobutyrate dehydrogenase in complex with NAD (see paper)
27% identity, 58% coverage: 2:259/444 of query aligns to 5:265/294 of 5je8B
2uyyA Structure of the cytokine-like nuclear factor n-pac
26% identity, 58% coverage: 2:257/444 of query aligns to 8:264/292 of 2uyyA
- binding [(2r,3r,4r,5r)-5-(6-amino-9h-purin-9-yl)-3-hydroxy-4-(phosphonooxy)tetrahydrofuran-2-yl]methyl [(2r,3s,4s)-3,4-dihydroxytetrahydrofuran-2-yl]methyl dihydrogen diphosphate: G15 (= G9), L16 (≠ A10), M17 (≠ L11), N36 (≠ D28), R37 (≠ I29), T38 (≠ N30), V70 (≠ L62), S71 (≠ P63), A75 (≠ D67), T101 (≠ S93), F237 (= F230), Y238 (≠ A231), Y241 (≠ L234), K244 (= K237)
Q49A26 Cytokine-like nuclear factor N-PAC; NPAC; 3-hydroxyisobutyrate dehydrogenase-like protein; Glyoxylate reductase 1 homolog; Nuclear protein NP60; Nuclear protein of 60 kDa; Nucleosome-destabilizing factor; hNDF; Putative oxidoreductase GLYR1 from Homo sapiens (Human) (see 3 papers)
26% identity, 58% coverage: 2:257/444 of query aligns to 269:525/553 of Q49A26
- 271:285 (vs. 4:18, 40% identical) binding
- T362 (≠ S93) binding
- M437 (≠ K169) mutation to K: Loss of tetramerization and protein stability.; mutation to N: No effect on tetramerization or protein stability.
- P496 (≠ T228) to L: decreased interaction with GATA4; decreased synergistic activation of GATA4 target genes transcription; detrimental effect on cardiomyocyte differentiation
- K505 (= K237) binding
Sites not aligning to the query:
- 214 D→A: Slightly reduced stimulation of KDM1B demethylase activity, but normal KDM1B-binding.
- 214:217 Interaction with histone H3
- 216 H→A: Slightly reduced stimulation of KDM1B demethylase activity, but normal KDM1B-binding.
- 216:225 Interaction with KDM1B
- 217 Required to promote KDM1B demethylase activity toward histone H3K4me1 and H3K4me2; F→A: Abolished stimulation of KDM1B demethylase activity, reduced affinity for histone H3 of the dimer with KDM1B, but normal KDM1B-binding.
- 219 H→A: Impaired KDM1B-binding and abolished stimulation of KDM1B demethylase activity; when associated with A-223.
- 220:222 FLL→AAA: Impaired KDM1B-binding and abolished stimulation of KDM1B demethylase activity.
- 223 S→A: Impaired KDM1B-binding and abolished stimulation of KDM1B demethylase activity; when associated with A-219.
Q922P9 Cytokine-like nuclear factor N-PAC; NPAC; Glyoxylate reductase 1 homolog; Nuclear protein NP60; Putative oxidoreductase GLYR1 from Mus musculus (Mouse) (see paper)
27% identity, 58% coverage: 2:257/444 of query aligns to 268:518/546 of Q922P9
- P489 (≠ T228) mutation to L: Mutant animals are born at expected Mendelian ratios. 54% mutants display postnatal lethality between days 0 and 1. They show centricular septal defects.
Q9I5I6 NAD-dependent L-serine dehydrogenase; L-serine 3-dehydrogenase (NAD(+)); EC 1.1.1.387 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
32% identity, 54% coverage: 2:239/444 of query aligns to 3:248/298 of Q9I5I6
- P66 (= P63) binding
- T96 (≠ S93) binding ; mutation to A: Almost abolished activity.
- S122 (= S119) mutation to A: Strongly reduced activity.
- K171 (= K169) active site
- N175 (= N173) mutation to A: Strongly reduced activity.
- W214 (≠ Q212) mutation to A: Almost abolished activity.
- Y219 (≠ M217) mutation to A: Strongly reduced activity.
- K246 (= K237) binding ; mutation to A: Almost abolished activity.
- D247 (= D238) mutation to A: Almost abolished activity.
Sites not aligning to the query:
3q3cA Crystal structure of a serine dehydrogenase from pseudomonas aeruginosa pao1 in complex with NAD (see paper)
32% identity, 54% coverage: 2:239/444 of query aligns to 2:246/294 of 3q3cA
- binding nicotinamide-adenine-dinucleotide: G9 (= G9), H10 (≠ A10), M11 (≠ L11), F29 (≠ W27), D30 (= D28), L31 (≠ I29), M63 (≠ C61), L64 (= L62), P65 (= P63), T94 (≠ S93), V119 (= V118), G121 (≠ A120), F237 (= F230), K244 (= K237)
P0A9V8 3-sulfolactaldehyde reductase; SLA reductase; 4-hydroxybutyrate dehydrogenase; Gamma-hydroxybutyrate dehydrogenase; GHBDH; Succinic semialdehyde reductase; SSA reductase; EC 1.1.1.373; EC 1.1.1.61 from Escherichia coli (strain K12)
30% identity, 58% coverage: 3:260/444 of query aligns to 4:263/298 of P0A9V8
- QM 11:12 (≠ AL 10:11) binding
- D31 (= D28) binding
- L65 (= L62) binding
- T96 (≠ S93) binding
- G122 (≠ S119) mutation to S: 25-fold decrease in catalytic efficiency with SLA as substrate. 5-fold decrease in catalytic efficiency with NADH as substrate.
- R123 (≠ A120) binding ; mutation to G: 130-fold decrease in catalytic efficiency with SLA as substrate. 3-fold decrease in catalytic efficiency with NADH as substrate.
- T124 (≠ S121) mutation to G: 230-fold decrease in catalytic efficiency with SLA as substrate. 12-fold decrease in catalytic efficiency with NADH as substrate.
- NNYMS 174:178 (≠ NNAMN 172:176) binding
- K240 (= K237) binding
6smyA Crystal structure of sla reductase yihu from e. Coli with nadh and product dhps
30% identity, 58% coverage: 3:260/444 of query aligns to 3:262/294 of 6smyA
Sites not aligning to the query:
6smzC Crystal structure of sla reductase yihu from e. Coli in complex with nadh
30% identity, 58% coverage: 3:260/444 of query aligns to 3:262/295 of 6smzC
- binding nicotinamide-adenine-dinucleotide: G9 (= G9), Q10 (≠ A10), M11 (≠ L11), F29 (≠ W27), D30 (= D28), V31 (≠ I29), M63 (≠ C61), L64 (= L62), V73 (≠ A71), S94 (≠ T92), T95 (≠ S93), R122 (≠ A120)
3pefA Crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter metallireducens in complex with NADP+ (see paper)
27% identity, 59% coverage: 2:264/444 of query aligns to 3:266/287 of 3pefA
- binding glycerol: D67 (≠ R64), G123 (≠ A120), K171 (= K169), N175 (= N173), M178 (≠ N176), L203 (≠ A201), G207 (≠ N205), N213 (= N211), A217 (≠ D215), F232 (= F230), H236 (≠ L234), K239 (= K237), R242 (≠ D240)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G10 (= G9), I11 (≠ A10), M12 (≠ L11), N31 (≠ D28), R32 (≠ I29), S33 (≠ N30), K36 (≠ A33), M64 (≠ C61), L65 (= L62), A66 (≠ P63), A70 (≠ D67), E73 (≠ S70), T96 (≠ S93), V121 (= V118), G123 (≠ A120), S124 (= S121), A231 (≠ N229), F232 (= F230), H236 (≠ L234), K239 (= K237)
Sites not aligning to the query:
3obbA Crystal structure of a possible 3-hydroxyisobutyrate dehydrogenase from pseudomonas aeruginosa pao1 (see paper)
31% identity, 54% coverage: 2:239/444 of query aligns to 3:247/295 of 3obbA
5u5gA Psf3 in complex with NADP+ and 2-opp (see paper)
29% identity, 54% coverage: 3:242/444 of query aligns to 3:244/286 of 5u5gA
- binding (2-oxopropyl)phosphonic acid: S122 (= S119), G123 (≠ A120), G124 (≠ S121), K171 (= K169), N175 (= N173), E178 (≠ N176), Y215 (≠ T213)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G7 (= G7), G9 (= G9), R10 (≠ A10), M11 (≠ L11), N30 (= N30), R31 (≠ T31), S32 (≠ A32), K35 (≠ A33), C63 (= C61), T64 (≠ L62), A65 (≠ P63), A69 (≠ D67), F73 (≠ A71), S95 (≠ T92), T96 (≠ S93), V232 (≠ F230), V236 (≠ L234), K239 (= K237)
6toeB Imine reductase from myxococcus stipitatus v8 variant in complex with NAD+
29% identity, 47% coverage: 6:215/444 of query aligns to 10:234/293 of 6toeB
- binding nicotinamide-adenine-dinucleotide: G11 (= G7), G13 (= G9), R14 (≠ A10), M15 (≠ L11), E34 (≠ D28), R39 (≠ A33), N67 (≠ C61), V68 (≠ L62), I69 (≠ P63), V73 (= V68), S97 (= S93), A124 (= A120), T125 (≠ S121), P126 (= P122)
Query Sequence
>AO356_30330 FitnessBrowser__pseudo5_N2C3_1:AO356_30330
MKIGYIGLGALGSQLARRFLSHSLCVWDINTAAVDTFKKLGADVAPTAADLARRCDVIFL
CLPRSSDVRSALFGPNGLAAGLVPGTLIIDQTSGIPGETRRMAEELAERGIDMMDAAVSA
SPLVVAEGKATLMVAGPDTVYERALPVLQVITQTIYRCGERVGDGQAMKMVNNAMNAGCR
LGTLEVVAMGKKAGLSLPLMADVLNRNKARNQTTDRMLPALAQGKPSTNFALALMLKDVD
QAVALGMSRDVPMPLTALVRALLQIGTNTLGPIAQLEDMVGLIESMAATKLYDGDAVKLT
TDGAPQACPEGDAIELVTGAIASLCSAITYECTAAGLRYGLALEDMAQVLEKTSGWSESS
RSIYTQLLSSHALDNTALSSEKTILKAACLRGNDLGAPMLIANAARSLFEQADHQISDPV
PIKDLSTFYSSISAVQFKPSSNCN
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory