Comparing AZOBR_RS00070 FitnessBrowser__azobra:AZOBR_RS00070 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
P94529 Arabinooligosaccharides transport system permease protein AraP from Bacillus subtilis (strain 168) (see paper)
29% identity, 90% coverage: 3:267/294 of query aligns to 22:286/313 of P94529
P02916 Maltose/maltodextrin transport system permease protein MalF from Escherichia coli (strain K12) (see 4 papers)
28% identity, 81% coverage: 53:290/294 of query aligns to 259:512/514 of P02916
4ki0F Crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to maltohexaose (see paper)
28% identity, 79% coverage: 53:283/294 of query aligns to 244:490/490 of 4ki0F
7cagA Mycobacterium smegmatis lpqy-sugabc complex in the catalytic intermediate state (see paper)
27% identity, 94% coverage: 8:283/294 of query aligns to 5:277/285 of 7cagA
>AZOBR_RS00070 FitnessBrowser__azobra:AZOBR_RS00070
MQRRVIFDNRALPYLLLAPQVAVTLIFFIWPAAQALWQSVHLQDAFGLRSQFVGLENFQA
VLSDPNYLETVKTTIVFSASVTVLSLASALGLAVMADSKIRAASAYKTLLIWPYALAPAV
AAVLWMFIFNPDIGILGRALNNLGYAWDYRLNDGQALTMVILAASWKQVSYNFIFFLAGL
QAIPRSVLEAASIDGAGAVRRFWTITFPLLSPTTFFLLVVNIVYAFFETFGTIHALTHGG
PGKATETLIFRVYQDGVVNHDLGGSSAQSVILMVIVIALTAIQFRFVERKVHYS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory