Comparing AZOBR_RS00395 FitnessBrowser__azobra:AZOBR_RS00395 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 10 hits to proteins with known functional sites (download)
O33341 Putative glutamine amidotransferase Rv2859c; EC 2.4.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
35% identity, 93% coverage: 9:229/237 of query aligns to 65:299/308 of O33341
3fijA Crystal structure of a uncharacterized protein lin1909
31% identity, 93% coverage: 9:228/237 of query aligns to 2:223/224 of 3fijA
P76038 Gamma-glutamyl-gamma-aminobutyrate hydrolase PuuD; Gamma-Glu-GABA hydrolase; EC 3.5.1.94 from Escherichia coli (strain K12) (see paper)
34% identity, 73% coverage: 50:221/237 of query aligns to 59:236/254 of P76038
6vtvB Crystal structure of puud gamma-glutamyl-gamma-aminobutyrate hydrolase from e. Coli
34% identity, 73% coverage: 50:221/237 of query aligns to 57:234/252 of 6vtvB
7d50B Spua mutant - h221n with glutamyl-thioester (see paper)
34% identity, 73% coverage: 50:222/237 of query aligns to 61:245/255 of 7d50B
7d53A Spua mutant - h221n with glu (see paper)
34% identity, 73% coverage: 50:222/237 of query aligns to 55:239/249 of 7d53A
7d4rB Spua native structure (see paper)
38% identity, 54% coverage: 99:226/237 of query aligns to 74:211/215 of 7d4rB
2vxoB Human gmp synthetase in complex with xmp (see paper)
33% identity, 57% coverage: 100:233/237 of query aligns to 77:196/658 of 2vxoB
Sites not aligning to the query:
1vcnA Crystal structure of t.Th. Hb8 ctp synthetase complex with sulfate anion (see paper)
33% identity, 48% coverage: 94:207/237 of query aligns to 353:484/506 of 1vcnA
Sites not aligning to the query:
1vcoA Crystal structure of t.Th. Hb8 ctp synthetase complex with glutamine (see paper)
32% identity, 48% coverage: 94:207/237 of query aligns to 366:508/531 of 1vcoA
Sites not aligning to the query:
>AZOBR_RS00395 FitnessBrowser__azobra:AZOBR_RS00395
MAAFIARGRPLIGVTASVHGSRIAWWANRLALRRAGARAVRITARDPFPIERLDGLVVGG
GDDIDAALYGETALPKMRIDPERDRLELCALDGAAARRLPVLGICRGSQMINVHRGGSLL
TDIHEVYEEAPRLRTVLPRKRIRIDPRSHLYRILGIAECRVNALHHQAVDRLGDGLRVVA
RETVGIVQGIEAVHHPFLIGVQWHPEYLVADQRQQALFRTLAATAAGTASLEDATAL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory