Comparing AZOBR_RS00430 FitnessBrowser__azobra:AZOBR_RS00430 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
44% identity, 81% coverage: 9:220/262 of query aligns to 23:229/378 of P69874
Sites not aligning to the query:
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
38% identity, 82% coverage: 3:217/262 of query aligns to 17:241/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
38% identity, 82% coverage: 3:217/262 of query aligns to 17:241/382 of 7aheC
Sites not aligning to the query:
7ahdC Opua (e190q) occluded (see paper)
37% identity, 82% coverage: 3:217/262 of query aligns to 17:241/260 of 7ahdC
Sites not aligning to the query:
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
39% identity, 81% coverage: 1:211/262 of query aligns to 4:217/375 of 2d62A
1g291 Malk (see paper)
41% identity, 72% coverage: 24:211/262 of query aligns to 18:214/372 of 1g291
Sites not aligning to the query:
8hplC Lpqy-sugabc in state 1 (see paper)
41% identity, 73% coverage: 21:212/262 of query aligns to 13:207/384 of 8hplC
Sites not aligning to the query:
8hprC Lpqy-sugabc in state 4 (see paper)
38% identity, 81% coverage: 2:212/262 of query aligns to 1:209/363 of 8hprC
8hprD Lpqy-sugabc in state 4 (see paper)
38% identity, 81% coverage: 2:212/262 of query aligns to 1:209/362 of 8hprD
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
36% identity, 83% coverage: 4:220/262 of query aligns to 4:223/226 of 5xu1B
3d31A Modbc from methanosarcina acetivorans (see paper)
40% identity, 69% coverage: 29:210/262 of query aligns to 20:201/348 of 3d31A
Sites not aligning to the query:
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
39% identity, 79% coverage: 4:211/262 of query aligns to 2:219/232 of 1f3oA
1l2tA Dimeric structure of mj0796, a bacterial abc transporter cassette (see paper)
39% identity, 79% coverage: 4:211/262 of query aligns to 2:219/230 of 1l2tA
P9WQI3 Trehalose import ATP-binding protein SugC; MtbSugC; Nucleotide-binding domain of SugABC transporter; NBD of SugABC transporter; SugABC transporter ATPase SugC; EC 7.5.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
36% identity, 80% coverage: 1:210/262 of query aligns to 1:208/393 of P9WQI3
P19566 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
36% identity, 87% coverage: 1:227/262 of query aligns to 1:223/369 of P19566
Sites not aligning to the query:
1oxvD Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
36% identity, 80% coverage: 1:210/262 of query aligns to 1:214/353 of 1oxvD
1oxvA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
36% identity, 80% coverage: 1:210/262 of query aligns to 1:214/353 of 1oxvA
1oxuA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
36% identity, 80% coverage: 1:210/262 of query aligns to 1:214/353 of 1oxuA
Q97UY8 Glucose import ATP-binding protein GlcV; EC 7.5.2.- from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
36% identity, 80% coverage: 1:210/262 of query aligns to 1:214/353 of Q97UY8
2awnB Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
37% identity, 76% coverage: 29:227/262 of query aligns to 22:222/374 of 2awnB
Sites not aligning to the query:
>AZOBR_RS00430 FitnessBrowser__azobra:AZOBR_RS00430
MSKLSIRNVEKTFPGRNSTAPTRALVPTSLEVADNDFITILGPSGCGKSTLLRIVAGLET
PTAGEVLLEGKAVSGPGPDRGMVFQSYTLFPWLTVRDNVCFGLRERGLPRAEQLAIADRF
LAQVGLKGFENHHPAQLSGGMQQRTALARALANDPKMLLLDEPFGALDHQTRELMQELLL
GIWEADRKTVMFVTHDIDEAIFMASRVVVMSARPGRIKCDIPIDLPHPRSYKVKTTPEFA
AYKERLTEEIRVETIKAVTMER
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory