Comparing AZOBR_RS00530 FitnessBrowser__azobra:AZOBR_RS00530 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 14 hits to proteins with known functional sites (download)
4z9nB Abc transporter / periplasmic binding protein from brucella ovis with glutathione bound
44% identity, 91% coverage: 29:347/349 of query aligns to 4:323/324 of 4z9nB
2v25A Structure of the campylobacter jejuni antigen peb1a, an aspartate and glutamate receptor with bound aspartate (see paper)
23% identity, 60% coverage: 33:242/349 of query aligns to 3:204/231 of 2v25A
5t0wA Crystal structure of the ancestral amino acid-binding protein anccdt- 1, a precursor of cyclohexadienyl dehydratase
25% identity, 60% coverage: 32:239/349 of query aligns to 2:197/229 of 5t0wA
5eyfB Crystal structure of solute-binding protein from enterococcus faecium with bound glutamate
23% identity, 54% coverage: 63:250/349 of query aligns to 37:214/243 of 5eyfB
2yjpA Crystal structure of the solute receptors for l-cysteine of neisseria gonorrhoeae (see paper)
30% identity, 34% coverage: 30:149/349 of query aligns to 1:118/247 of 2yjpA
Sites not aligning to the query:
6h2tA Glnh bound to glu, mycobacterium tuberculosis (see paper)
31% identity, 39% coverage: 35:169/349 of query aligns to 47:179/288 of 6h2tA
Sites not aligning to the query:
6h20A Glnh bound to asn, mycobacterium tuberculosis (see paper)
31% identity, 39% coverage: 35:169/349 of query aligns to 46:178/287 of 6h20A
Sites not aligning to the query:
6h1uA Glnh bound to asp, mycobacterium tuberculosis (see paper)
31% identity, 39% coverage: 35:169/349 of query aligns to 46:178/287 of 6h1uA
Sites not aligning to the query:
1xt8B Crystal structure of cysteine-binding protein from campylobacter jejuni at 2.0 a resolution (see paper)
25% identity, 34% coverage: 32:149/349 of query aligns to 6:121/251 of 1xt8B
Sites not aligning to the query:
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
26% identity, 58% coverage: 39:239/349 of query aligns to 3:194/226 of 4zv1A
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
26% identity, 58% coverage: 39:239/349 of query aligns to 3:192/225 of 4zv2A
2ia4B Crystal structure of novel amino acid binding protein from shigella flexneri
21% identity, 64% coverage: 22:245/349 of query aligns to 1:221/278 of 2ia4B
2vhaA Debp (see paper)
22% identity, 64% coverage: 23:245/349 of query aligns to 1:220/276 of 2vhaA
2ylnA Crystal structure of the l-cystine solute receptor of neisseria gonorrhoeae in the closed conformation (see paper)
29% identity, 34% coverage: 33:149/349 of query aligns to 7:119/240 of 2ylnA
Sites not aligning to the query:
>AZOBR_RS00530 FitnessBrowser__azobra:AZOBR_RS00530
MGLVRSFARAAVVAAVLAAAVSAPSGGPRAETMEDVRERGLLRCGVSSSGAGLAAVDDSG
NWRGFFVDMCRALAAAVAGKADRVEFVETNSENRFAILRNGEVDVVMEGTTWTLQRDATF
GIDFPAVYLFDGQGFIAHRAHGVARLSDLPPGASVCVIEQTTTLRNLEDWMARTGVRFRL
KRVRSTEGALSAFFNHHCDLYTSDRIGLHAQRLLKAPERDDYVILPEAISKEPLGPMVRP
DERRWFDIVRWVFLATVLAEEKGITAANAPRLKEEAQDPEVRRLLGATTGVGWGLGLDDD
WAFRVITQVGNYGEIFDRHLGAASPLGIDRGMNGLWMNGGLHYAPPLGG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory