Comparing AZOBR_RS00685 FitnessBrowser__azobra:AZOBR_RS00685 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5itoA Structure of the periplasmic binding protein m117n-noct from a. Tumefaciens in complex with octopine (see paper)
48% identity, 91% coverage: 25:276/278 of query aligns to 1:254/255 of 5itoA
5ovzA High resolution structure of the pbp noct in complex with nopaline (see paper)
48% identity, 91% coverage: 25:278/278 of query aligns to 1:256/259 of 5ovzA
5otcA Structure of the periplasmic binding protein (pbp) noct from agrobacterium tumefaciens c58 in complex with noroctopinic acid. (see paper)
47% identity, 91% coverage: 26:278/278 of query aligns to 1:255/256 of 5otcA
5otaA Structure of the periplasmic binding protein (pbp) noct from agrobacterium tumefaciens c58 in complex with octopinic acid (see paper)
47% identity, 90% coverage: 26:276/278 of query aligns to 1:253/254 of 5otaA
5ot9A Structure of the periplasmic binding protein (pbp) noct from a.Tumefaciens c58 in complex with histopine. (see paper)
47% identity, 90% coverage: 26:276/278 of query aligns to 1:253/254 of 5ot9A
4powA Structure of the pbp noct in complex with pyronopaline (see paper)
47% identity, 90% coverage: 26:276/278 of query aligns to 1:253/254 of 4powA
8hqrA Crystal structure of the arginine-/lysine-binding protein sar11_1210 from 'candidatus pelagibacter ubique' htcc1062 bound to arginine
46% identity, 90% coverage: 28:277/278 of query aligns to 9:267/267 of 8hqrA
5orgA Structure of the periplasmic binding protein (pbp) occj from a. Tumefaciens b6 in complex with octopine. (see paper)
43% identity, 90% coverage: 27:276/278 of query aligns to 4:255/257 of 5orgA
1hslA Refined 1.89 angstroms structure of the histidine-binding protein complexed with histidine and its relationship with many other active transport(slash)chemosensory receptors (see paper)
38% identity, 90% coverage: 27:275/278 of query aligns to 4:235/238 of 1hslA
P02910 Histidine-binding periplasmic protein; HBP from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 2 papers)
38% identity, 90% coverage: 27:275/278 of query aligns to 26:257/260 of P02910
Sites not aligning to the query:
P0AEU0 Histidine-binding periplasmic protein; HBP from Escherichia coli (strain K12) (see 3 papers)
37% identity, 90% coverage: 27:275/278 of query aligns to 26:257/260 of P0AEU0
Sites not aligning to the query:
P02911 Lysine/arginine/ornithine-binding periplasmic protein; LAO-binding protein from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 4 papers)
36% identity, 99% coverage: 1:275/278 of query aligns to 1:257/260 of P02911
5owfA Structure of a lao-binding protein mutant with glutamine (see paper)
35% identity, 89% coverage: 29:275/278 of query aligns to 3:232/235 of 5owfA
1lstA Three-dimensional structures of the periplasmic lysine-, arginine-, ornithine-binding protein with and without a ligand (see paper)
36% identity, 89% coverage: 29:275/278 of query aligns to 6:235/238 of 1lstA
1lahE Structural bases for multiple ligand specificity of the periplasmic lysine-, arginine-, ornithine-binding protein (see paper)
36% identity, 89% coverage: 29:275/278 of query aligns to 6:235/238 of 1lahE
1lagE Structural bases for multiple ligand specificity of the periplasmic lysine-, arginine-, ornithine-binding protein (see paper)
36% identity, 89% coverage: 29:275/278 of query aligns to 6:235/238 of 1lagE
1lafE Structural bases for multiple ligand specificity of the periplasmic lysine-, arginine-, ornithine-binding protein (see paper)
36% identity, 89% coverage: 29:275/278 of query aligns to 6:235/238 of 1lafE
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
32% identity, 88% coverage: 29:272/278 of query aligns to 6:224/225 of 4zv2A
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
32% identity, 88% coverage: 29:272/278 of query aligns to 6:226/226 of 4zv1A
3i6vA Crystal structure of a periplasmic his/glu/gln/arg/opine family- binding protein from silicibacter pomeroyi in complex with lysine
36% identity, 90% coverage: 29:277/278 of query aligns to 2:217/218 of 3i6vA
>AZOBR_RS00685 FitnessBrowser__azobra:AZOBR_RS00685
VKKIVAALALGAIVAVAGTAAEAKDWKKIRIATEGAYAPWNATDPSGKLIGFEPDLALEL
CKRIKAECEIVAQDWDGMIPAIQQGKYDAIMAAMSITDEREKVIAFAGPYGTEPSMFGTM
KNSPLAKATFPGERYDLSKDDPKAAIAALADALKGKTVGVQTSTIQANFMEKLLPQVAVR
TYDKLDNAGIDMAAGRVDAIFGDRSAVDAILKADAGNGMTLFGPAFARGVLGKGVGVGLR
KADGDLKELFNKAIAEANQDGTITKLSTQHFGYDISIK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory