Comparing AZOBR_RS01080 FitnessBrowser__azobra:AZOBR_RS01080 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4lmaA Crystal structure analysis of o-acetylserine sulfhydrylase cysk1 from microcystis aeruginosa 7806 (see paper)
65% identity, 97% coverage: 9:319/319 of query aligns to 2:312/318 of 4lmaA
4lmbA Crystal structure analysis of o-acetylserine sulfhydrylase cysk2 complexed with cystine from microcystis aeruginosa 7806 (see paper)
65% identity, 96% coverage: 10:316/319 of query aligns to 3:309/310 of 4lmbA
P9WP55 O-acetylserine sulfhydrylase; OAS sulfhydrylase; OASS; Cysteine synthase A; CSase A; O-acetylserine (thiol)-lyase A; OAS-TL A; O-acetylserine-specific cysteine synthase; Sulfide-dependent cysteine synthase; EC 2.5.1.47 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
62% identity, 96% coverage: 10:315/319 of query aligns to 3:305/310 of P9WP55
2q3dA 2.2 a resolution crystal structure of o-acetylserine sulfhydrylase (oass) from mycobacterium tuberculosis in complex with the reaction intermediate alpha-aminoacrylate (see paper)
62% identity, 96% coverage: 10:315/319 of query aligns to 3:305/306 of 2q3dA
3zeiA Structure of the mycobacterium tuberculosis o-acetylserine sulfhydrylase (oass) cysk1 in complex with a small molecule inhibitor (see paper)
62% identity, 94% coverage: 10:310/319 of query aligns to 3:300/300 of 3zeiA
2q3cA 2.1 a resolution crystal structure of o-acetylserine sulfhydrylase (oass) holoenzyme from mycobacterium tuberculosis in complex with the inhibitory peptide dfsi (see paper)
62% identity, 94% coverage: 10:310/319 of query aligns to 3:300/300 of 2q3cA
4aecA Crystal structure of the arabidopsis thaliana o-acetyl-serine-(thiol)- lyasE C (see paper)
58% identity, 97% coverage: 10:318/319 of query aligns to 13:319/323 of 4aecA
P47999 Cysteine synthase, chloroplastic/chromoplastic; At.OAS.7-4; Beta-substituted Ala synthase 2;1; ARAth-Bsas2;1; CSase B; AtCS-B; CS-B; O-acetylserine (thiol)-lyase; O-acetylserine sulfhydrylase; OAS-TL B; cpACS1; EC 2.5.1.47 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
58% identity, 97% coverage: 10:318/319 of query aligns to 75:381/392 of P47999
Sites not aligning to the query:
P47998 Cysteine synthase 1; At.OAS.5-8; Beta-substituted Ala synthase 1;1; ARAth-Bsas1;1; CSase A; AtCS-A; Cys-3A; O-acetylserine (thiol)-lyase 1; OAS-TL A; O-acetylserine sulfhydrylase; Protein ONSET OF LEAF DEATH 3; EC 2.5.1.47 from Arabidopsis thaliana (Mouse-ear cress) (see 3 papers)
59% identity, 97% coverage: 9:316/319 of query aligns to 4:309/322 of P47998
2isqA Crystal structure of o-acetylserine sulfhydrylase from arabidopsis thaliana in complex with c-terminal peptide from arabidopsis serine acetyltransferase (see paper)
59% identity, 97% coverage: 9:316/319 of query aligns to 2:307/320 of 2isqA
7n2tA O-acetylserine sulfhydrylase from citrullus vulgaris in the internal aldimine state, with citrate bound (see paper)
58% identity, 97% coverage: 10:318/319 of query aligns to 3:309/309 of 7n2tA
1z7yA Crystal structure of the arabidopsis thaliana o-acetylserine sulfhydrylase k46a mutant (see paper)
58% identity, 97% coverage: 9:316/319 of query aligns to 2:307/320 of 1z7yA
5xoqA Crystal structure of o-acetylserine sulfhydrylase with bound transcription factor peptide inhibitor from planctomyces limnophilus
57% identity, 97% coverage: 10:318/319 of query aligns to 4:309/310 of 5xoqA
6z4nAAA structure of oass complexed with upar inhibitor (see paper)
59% identity, 97% coverage: 9:318/319 of query aligns to 4:316/321 of 6z4nAAA
P0A1E3 Cysteine synthase A; CSase A; O-acetylserine (thiol)-lyase A; OAS-TL A; O-acetylserine sulfhydrylase A; EC 2.5.1.47 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 4 papers)
59% identity, 97% coverage: 9:318/319 of query aligns to 3:315/323 of P0A1E3
Sites not aligning to the query:
1d6sA Crystal structure of the k41a mutant of o-acetylserine sulfhydrylase complexed in external aldimine linkage with methionine (see paper)
59% identity, 97% coverage: 9:318/319 of query aligns to 2:314/322 of 1d6sA
P0ABK5 Cysteine synthase A; CSase A; O-acetylserine (thiol)-lyase A; OAS-TL A; O-acetylserine sulfhydrylase A; S-carboxymethylcysteine synthase; Sulfate starvation-induced protein 5; SSI5; EC 2.5.1.47; EC 4.5.1.5 from Escherichia coli (strain K12) (see 5 papers)
58% identity, 97% coverage: 9:318/319 of query aligns to 3:315/323 of P0ABK5
Sites not aligning to the query:
8b9wA Cysteine synthase from trypanosoma theileri with plp bound (see paper)
54% identity, 93% coverage: 18:315/319 of query aligns to 17:311/329 of 8b9wA
3t4pA Crystal structure of o-acetyl serine sulfhydrylase from leishmania donovani in complex with designed tetrapeptide (see paper)
53% identity, 97% coverage: 10:318/319 of query aligns to 10:315/319 of 3t4pA
3vbeC Crystal structure of beta-cyanoalanine synthase in soybean (see paper)
49% identity, 97% coverage: 9:318/319 of query aligns to 10:317/329 of 3vbeC
>AZOBR_RS01080 FitnessBrowser__azobra:AZOBR_RS01080
MPGSEFRGKIYDSILDTVGATPLVRVNRLAEDAGAKAQIVGKLEFFNPLASVKDRIGFAM
IDAAERAGTIEPGRTTLVEPTSGNTGIALAFVAAAKGYRLILTMPESMSVERRKMLKLLG
AELVLTPAAEGMKGAIRRADEIVATDPNAYMLQQFKNAANPEIHRNTTAEEIWKDTDGKA
DFLISGVGTGGTLTGVSEVLKARKPGFRTIAVEPEDSPVLSGGMPGPHKIQGIGAGFVPD
VLNKDLIDEVVRISNQRAFETARKVAKLEGIPVGISSGAALAAALEIGSRPENEGKLIVV
ILPSFAERYLSTALFEGLE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory