SitesBLAST
Comparing AZOBR_RS01325 FitnessBrowser__azobra:AZOBR_RS01325 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5aovA Ternary crystal structure of pyrococcus furiosus glyoxylate hydroxypyruvate reductase in presence of glyoxylate (see paper)
46% identity, 97% coverage: 6:324/329 of query aligns to 2:321/334 of 5aovA
- active site: L100 (= L105), R241 (= R244), D265 (= D268), E270 (= E273), H288 (= H291)
- binding glyoxylic acid: M52 (≠ T56), L53 (≠ V57), L53 (≠ V57), Y74 (≠ F79), A75 (≠ G80), V76 (≠ T81), G77 (= G82), R241 (= R244), H288 (= H291)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V76 (≠ T81), T104 (= T109), F158 (≠ M159), G159 (= G160), R160 (= R161), I161 (= I162), S180 (≠ N181), R181 (= R182), A211 (≠ N214), V212 (≠ C215), P213 (= P216), T218 (= T221), I239 (≠ T242), A240 (≠ S243), R241 (= R244), H288 (= H291), G290 (= G293)
6biiA Crystal structure of pyrococcus yayanosii glyoxylate hydroxypyruvate reductase in complex with NADP and malonate (re-refinement of 5aow) (see paper)
45% identity, 96% coverage: 6:321/329 of query aligns to 1:317/332 of 6biiA
- active site: L99 (= L105), R240 (= R244), D264 (= D268), E269 (= E273), H287 (= H291)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V75 (≠ T81), T103 (= T109), G156 (= G158), F157 (≠ M159), G158 (= G160), R159 (= R161), I160 (= I162), A179 (≠ N181), R180 (= R182), S181 (≠ R183), K183 (≠ Y186), V211 (≠ C215), P212 (= P216), E216 (≠ A220), T217 (= T221), V238 (≠ T242), A239 (≠ S243), R240 (= R244), D264 (= D268), H287 (= H291), G289 (= G293)
O58320 Glyoxylate reductase; EC 1.1.1.26 from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
46% identity, 96% coverage: 6:321/329 of query aligns to 2:318/334 of O58320
2dbqA Crystal structure of glyoxylate reductase (ph0597) from pyrococcus horikoshii ot3, complexed with NADP (i41) (see paper)
46% identity, 96% coverage: 6:321/329 of query aligns to 2:318/333 of 2dbqA
- active site: L100 (= L105), R241 (= R244), D265 (= D268), E270 (= E273), H288 (= H291)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V76 (≠ T81), T104 (= T109), L158 (≠ M159), G159 (= G160), R160 (= R161), I161 (= I162), S180 (≠ N181), R181 (= R182), T182 (≠ R183), A211 (≠ N214), V212 (≠ C215), P213 (= P216), T218 (= T221), I239 (≠ T242), A240 (≠ S243), R241 (= R244), D265 (= D268), H288 (= H291), G290 (= G293)
3bazA Structure of hydroxyphenylpyruvate reductase from coleus blumei in complex with NADP+ (see paper)
42% identity, 78% coverage: 62:317/329 of query aligns to 56:303/311 of 3bazA
- active site: L98 (= L105), R230 (= R244), A251 (= A265), D254 (= D268), E259 (= E273), H277 (= H291)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V74 (≠ T81), G149 (= G158), L150 (≠ M159), G151 (= G160), R152 (= R161), I153 (= I162), S172 (≠ N181), R173 (= R182), S174 (≠ R183), C201 (= C215), P202 (= P216), T207 (= T221), I228 (≠ T242), G229 (≠ S243), R230 (= R244), D254 (= D268), H277 (= H291), G279 (= G293)
Q65CJ7 Hydroxyphenylpyruvate reductase; HPPR; EC 1.1.1.237 from Plectranthus scutellarioides (Coleus) (Solenostemon scutellarioides) (see paper)
42% identity, 78% coverage: 62:317/329 of query aligns to 58:305/313 of Q65CJ7
2gcgA Ternary crystal structure of human glyoxylate reductase/hydroxypyruvate reductase (see paper)
35% identity, 90% coverage: 9:303/329 of query aligns to 5:301/324 of 2gcgA
- active site: L103 (= L105), R241 (= R244), D265 (= D268), E270 (= E273), H289 (= H291)
- binding (2r)-2,3-dihydroxypropanoic acid: L55 (≠ V57), S78 (≠ G80), V79 (≠ T81), G80 (= G82), R241 (= R244), H289 (= H291)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: V79 (≠ T81), T107 (= T109), G156 (= G158), G158 (= G160), I160 (= I162), G180 (≠ R182), R181 (= R183), R184 (≠ Y186), C212 (= C215), S213 (≠ P216), T218 (= T221), I239 (≠ T242), R241 (= R244), D265 (= D268), H289 (= H291), G291 (= G293)
Q9UBQ7 Glyoxylate reductase/hydroxypyruvate reductase; EC 1.1.1.79; EC 1.1.1.81 from Homo sapiens (Human) (see paper)
35% identity, 90% coverage: 9:303/329 of query aligns to 9:305/328 of Q9UBQ7
- VG 83:84 (≠ TG 81:82) binding substrate
- GRI 162:164 (= GRI 160:162) binding NADP(+)
- RQPR 185:188 (≠ RRVY 183:186) binding NADP(+)
- S217 (≠ P216) binding NADP(+)
- I243 (≠ T242) binding NADP(+)
- R245 (= R244) binding substrate
- D269 (= D268) binding substrate
- HIGS 293:296 (≠ HMGS 291:294) binding substrate
- G295 (= G293) binding NADP(+)
5v6qB Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc04462 (smghrb) from sinorhizobium meliloti in complex with NADP and malonate (see paper)
38% identity, 96% coverage: 5:319/329 of query aligns to 2:306/319 of 5v6qB
- active site: L96 (= L105), R230 (= R244), D254 (= D268), E259 (= E273), H277 (= H291)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V72 (≠ T81), V100 (≠ T109), F148 (≠ L157), L150 (≠ M159), G151 (= G160), R152 (= R161), I153 (= I162), T172 (≠ N181), R173 (= R182), V201 (≠ C215), P202 (= P216), S206 (≠ A220), T207 (= T221), V228 (≠ T242), G229 (≠ S243), R230 (= R244), H277 (= H291), A279 (≠ G293)
5v7nA Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc04462 (smghrb) from sinorhizobium meliloti in complex with NADP and 2-keto-d-gluconic acid (see paper)
38% identity, 96% coverage: 5:319/329 of query aligns to 1:305/319 of 5v7nA
- active site: L95 (= L105), R229 (= R244), D253 (= D268), E258 (= E273), H276 (= H291)
- binding 2-keto-D-gluconic acid: G70 (= G80), V71 (≠ T81), G72 (= G82), R229 (= R244), H276 (= H291), S279 (= S294), R285 (= R300)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V71 (≠ T81), V99 (≠ T109), L149 (≠ M159), G150 (= G160), R151 (= R161), I152 (= I162), T171 (≠ N181), R172 (= R182), V200 (≠ C215), P201 (= P216), S205 (≠ A220), T206 (= T221), V227 (≠ T242), G228 (≠ S243), R229 (= R244), H276 (= H291), A278 (≠ G293)
5v7gA Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc04462 (smghrb) from sinorhizobium meliloti in complex with NADPH and oxalate (see paper)
38% identity, 95% coverage: 6:319/329 of query aligns to 1:304/317 of 5v7gA
- active site: L94 (= L105), R228 (= R244), D252 (= D268), E257 (= E273), H275 (= H291)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: V70 (≠ T81), V98 (≠ T109), F146 (≠ L157), L148 (≠ M159), G149 (= G160), R150 (= R161), I151 (= I162), T170 (≠ N181), R171 (= R182), V199 (≠ C215), P200 (= P216), S204 (≠ A220), T205 (= T221), V226 (≠ T242), G227 (≠ S243), R228 (= R244), H275 (= H291), A277 (≠ G293)
- binding oxalate ion: G69 (= G80), V70 (≠ T81), G71 (= G82), R228 (= R244), H275 (= H291)
5j23A Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc04462 (smghrb) from sinorhizobium meliloti in complex with 2'-phospho-adp-ribose (see paper)
38% identity, 95% coverage: 6:319/329 of query aligns to 1:304/318 of 5j23A
- active site: L94 (= L105), R228 (= R244), D252 (= D268), E257 (= E273), H275 (= H291)
- binding [(2r,3r,4r,5r)-5-(6-amino-9h-purin-9-yl)-3-hydroxy-4-(phosphonooxy)tetrahydrofuran-2-yl]methyl [(2r,3s,4r,5r)-3,4,5-trihydroxytetrahydrofuran-2-yl]methyl dihydrogen diphosphate: V70 (≠ T81), L148 (≠ M159), G149 (= G160), R150 (= R161), I151 (= I162), T170 (≠ N181), R171 (= R182), P200 (= P216), S204 (≠ A220), T205 (= T221), R228 (= R244)
1wwkA Crystal structure of phosphoglycerate dehydrogenase from pyrococcus horikoshii ot3
39% identity, 81% coverage: 42:308/329 of query aligns to 34:299/304 of 1wwkA
- active site: S96 (≠ L105), R230 (= R244), D254 (= D268), E259 (= E273), H278 (= H291)
- binding nicotinamide-adenine-dinucleotide: V100 (≠ T109), G146 (= G158), F147 (≠ M159), G148 (= G160), R149 (= R161), I150 (= I162), Y168 (≠ H180), D169 (≠ N181), P170 (≠ R182), V201 (≠ C215), P202 (= P216), T207 (= T221), T228 (= T242), S229 (= S243), D254 (= D268), H278 (= H291), G280 (= G293)
4e5pA Thermostable phosphite dehydrogenase a176r variant in complex with nad (see paper)
30% identity, 97% coverage: 7:324/329 of query aligns to 3:325/332 of 4e5pA
- active site: L100 (= L105), R237 (= R244), D261 (= D268), E266 (= E273), H292 (= H291)
- binding nicotinamide-adenine-dinucleotide: K76 (≠ T81), L100 (= L105), T104 (= T109), G154 (= G160), A155 (≠ R161), I156 (= I162), A175 (≠ N181), R176 (= R182), L208 (≠ C215), P209 (= P216), T214 (= T221), P235 (≠ T242), C236 (≠ S243), R237 (= R244), H292 (= H291)
6ih6A Phosphite dehydrogenase mutant i151r/p176r/m207a from ralstonia sp. 4506 in complex with non-natural cofactor nicotinamide cytosine dinucleotide
35% identity, 96% coverage: 6:320/329 of query aligns to 2:322/330 of 6ih6A
- binding [[(2S,3S,4R,5S)-5-(3-aminocarbonylpyridin-1-ium-1-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] [(2S,3S,4R,5S)-5-(4-azanyl-2-oxidanylidene-pyrimidin-1-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methyl hydrogen phosphate: T104 (= T109), R151 (≠ L157), G154 (= G160), A155 (≠ R161), V156 (≠ I162), D175 (≠ N181), A207 (≠ N214), V208 (≠ C215), P209 (= P216), T214 (= T221), A235 (≠ T242), C236 (≠ S243), R237 (= R244)
4e5mA Thermostable phosphite dehydrogenase e175a/a176r in complex with NADP (see paper)
30% identity, 97% coverage: 7:324/329 of query aligns to 3:325/329 of 4e5mA
- active site: L100 (= L105), R237 (= R244), D261 (= D268), E266 (= E273), H292 (= H291)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: K76 (≠ T81), L100 (= L105), T104 (= T109), G154 (= G160), A155 (≠ R161), I156 (= I162), R176 (= R182), L208 (≠ C215), P209 (= P216), T214 (= T221), P235 (≠ T242), C236 (≠ S243), R237 (= R244), H292 (= H291), G294 (= G293)
4e5kA Thermostable phosphite dehydrogenase in complex with NAD and sulfite (see paper)
30% identity, 97% coverage: 7:324/329 of query aligns to 3:325/329 of 4e5kA
- active site: L100 (= L105), R237 (= R244), D261 (= D268), E266 (= E273), H292 (= H291)
- binding nicotinamide-adenine-dinucleotide: K76 (≠ T81), G77 (= G82), L100 (= L105), T104 (= T109), G152 (= G158), G154 (= G160), A155 (≠ R161), I156 (= I162), H174 (= H180), E175 (≠ N181), A176 (≠ R182), A207 (≠ N214), L208 (≠ C215), P209 (= P216), P235 (≠ T242), C236 (≠ S243), R237 (= R244), D261 (= D268), H292 (= H291), G294 (= G293)
- binding sulfite ion: M53 (≠ V57), L75 (≠ G80), K76 (≠ T81), G77 (= G82), L100 (= L105), R237 (= R244), H292 (= H291)
6plfA Crystal structure of human phgdh complexed with compound 1 (see paper)
31% identity, 86% coverage: 34:317/329 of query aligns to 28:305/305 of 6plfA
7dkmA Phgdh covalently linked to oridonin (see paper)
31% identity, 84% coverage: 34:311/329 of query aligns to 28:299/306 of 7dkmA
- binding nicotinamide-adenine-dinucleotide: T74 (= T81), A102 (≠ T109), G148 (= G158), R151 (= R161), I152 (= I162), Y170 (= Y179), D171 (≠ H180), P172 (= P187), I173 (≠ D188), H202 (≠ N214), T203 (≠ C215), P204 (= P216), T209 (= T221), C230 (≠ T242), A231 (≠ S243), R232 (= R244), H279 (= H291), G281 (= G293)
- binding (1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14R,16beta)-1,6,7,14-tetrahydroxy-7,20-epoxykauran-15-one: E293 (= E305)
Sites not aligning to the query:
- binding (1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14R,16beta)-1,6,7,14-tetrahydroxy-7,20-epoxykauran-15-one: 14, 17, 18
O43175 D-3-phosphoglycerate dehydrogenase; 3-PGDH; 2-oxoglutarate reductase; Malate dehydrogenase; EC 1.1.1.95; EC 1.1.1.399; EC 1.1.1.37 from Homo sapiens (Human) (see 3 papers)
31% identity, 87% coverage: 34:319/329 of query aligns to 32:311/533 of O43175
- T78 (= T81) binding NAD(+)
- R135 (≠ P141) to W: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606949
- RI 155:156 (= RI 161:162) binding NAD(+)
- D175 (≠ H180) binding NAD(+)
- T207 (≠ C215) binding NAD(+)
- CAR 234:236 (≠ TSR 242:244) binding NAD(+)
- D260 (= D268) binding NAD(+)
- V261 (= V269) to M: in PHGDHD; results in a four-fold decrease in substrate affinity and a slight increase in maximal enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs267606947
- HLGA 283:286 (≠ HMGS 291:294) binding NAD(+)
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
- 373 A → T: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs201553627
- 377 G → S: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606948
- 425 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907988
- 490 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907987
Query Sequence
>AZOBR_RS01325 FitnessBrowser__azobra:AZOBR_RS01325
MTEKKKPLVVVTRKLPDVIETRMMELFDARLNSDDEPLTHAQLIDVVQTADVLVPTVTDR
IDREVIEKAGPQLRLIASFGTGVDHIDLKAARERGISVTNTPGVLTEDTADMTMALLLAV
GRRVAEGERLVRSGQWKGWGPTTMLGHRIQGKRLGILGMGRIGQALARRARAFGMSIHYH
NRRRVYPDVEQELEATYWESLDQMLARMDVVSINCPHTPATYHLLSERRLKLLRPHCFIV
NTSRGEVIDETALTRMLSKGEIAGAGLDVFEHEPAVNPKLLRLDNVVLLPHMGSATIEGR
IDMGEKVIINIKTFADGHAPPDRVLETLL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory