SitesBLAST
Comparing AZOBR_RS01360 FitnessBrowser__azobra:AZOBR_RS01360 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
Q9XBQ8 L-lysine 2,3-aminomutase; LAM; KAM; EC 5.4.3.2 from Clostridium subterminale (see paper)
41% identity, 95% coverage: 16:342/344 of query aligns to 40:365/416 of Q9XBQ8
- E86 (= E62) mutation to Q: Reduction in activity. Decrease in iron and sulfide and PLP content.
- D96 (= D72) mutation to N: Reduction in activity. Decrease in iron and sulfide and PLP content.
- R130 (= R106) mutation R->Q,K: Complete loss of activity. Decrease in iron and sulfide but not PLP content. Destabilise the iron-sulfur centers.
- R134 (= R110) mutation to K: Complete loss of activity. Significant decrease in iron and sulfide and PLP content.; mutation to Q: Complete loss of activity. Slight decrease in iron and sulfide and PLP content.
- R135 (= R111) mutation to K: Reduction in activity. Decrease in iron and sulfide and PLP content.; mutation to Q: Reduction in activity. Significant decrease in iron and sulfide and PLP content.
- R136 (≠ E112) mutation to Q: Reduction in activity. Significant decrease in iron and sulfide and PLP content.
- D165 (≠ E141) mutation to N: Significant reduction in activity. Decrease in iron and sulfide and PLP content.
- D172 (= D148) mutation to N: Complete loss of activity. Decrease in iron and sulfide and PLP content. Destabilise the iron-sulfur centers.
- E236 (= E213) mutation to Q: Significant reduction in activity. Decrease in iron and sulfide and PLP content.
- D293 (= D270) mutation to N: Complete loss of activity. Decrease in iron and sulfide and PLP content.
- D330 (= D307) mutation D->A,N: Complete loss of activity. Decrease in iron and sulfide and PLP content.
2a5hB 2.1 angstrom x-ray crystal structure of lysine-2,3-aminomutase from clostridium subterminale sb4, with michaelis analog (l-alpha-lysine external aldimine form of pyridoxal-5'-phosphate). (see paper)
41% identity, 95% coverage: 16:342/344 of query aligns to 38:363/410 of 2a5hB
- active site: R110 (= R88), Y111 (= Y89), R114 (= R92), C123 (= C101), C127 (= C105), C130 (= C108), R132 (= R110), D291 (= D270), D328 (= D307), K335 (= K314)
- binding lysine: L96 (≠ I74), L116 (= L94), R132 (= R110), L165 (≠ V143), S167 (≠ T145), Y288 (≠ H267), D291 (= D270), D328 (= D307)
- binding pyridoxal-5'-phosphate: T108 (≠ V86), Y111 (= Y89), R114 (= R92), L116 (= L94), R196 (= R174), Y285 (= Y264), Y286 (= Y265), K335 (= K314)
- binding s-adenosylmethionine: H129 (≠ F107), T131 (≠ F109), R132 (= R110), S167 (≠ T145), G169 (= G147), G198 (≠ H176), H228 (= H207), Q256 (= Q235), V258 (= V237), Y288 (≠ H267), C290 (≠ P269), D291 (= D270)
- binding iron/sulfur cluster: C123 (= C101), C127 (= C105), C130 (= C108), G169 (= G147), R200 (= R178), H228 (= H207)
Sites not aligning to the query:
O34676 L-lysine 2,3-aminomutase; LAM; KAM; EC 5.4.3.2 from Bacillus subtilis (strain 168) (see paper)
36% identity, 99% coverage: 3:342/344 of query aligns to 36:374/471 of O34676
- K290 (≠ R258) mutation to Q: More than 95% loss of activity, and half of normal PLP binding capacity.
- K346 (= K314) mutation to Q: No activity and no bound PLP.
- K361 (≠ G329) mutation to Q: 95% loss of activity, normal PLP binding capacity.
Query Sequence
>AZOBR_RS01360 FitnessBrowser__azobra:AZOBR_RS01360
MKAAHSVTDLVAAGLMTPAAGEAVAAVADRYAIALTPYLLEALADAAPGDPLYAQYVPSP
EEAYTAPEEREDPIGDVVRSPVKGIVHRYPDRVLLKPLHACAVYCRFCFRREMVGPGGEA
LAPEELDAALAYVRARPEVWEVVVTGGDPLLLSPRRLSHIVRSLSDIPHVGVVRLHTRIP
VADPARVTPELVEALKAPDLATWMAIHVNHADELTEPARGAIARLADAGIPLLGQTVLLK
GINDDAAALEALFRGLVRNRIKPYYLHHPDLAAGTSHFRPTLAEGQALVKGLRGRVSGLC
QPTYVLDIPGGHGKAPAAPGWVRPDGEGGYLAEDFTGATHRYRG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory