Comparing AZOBR_RS01690 FitnessBrowser__azobra:AZOBR_RS01690 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 2 hits to proteins with known functional sites (download)
6j2lA Crystal structure of bi-functional enzyme (see paper)
55% identity, 68% coverage: 23:99/113 of query aligns to 124:200/200 of 6j2lA
Sites not aligning to the query:
6j2lB Crystal structure of bi-functional enzyme (see paper)
47% identity, 58% coverage: 34:99/113 of query aligns to 120:185/185 of 6j2lB
Sites not aligning to the query:
>AZOBR_RS01690 FitnessBrowser__azobra:AZOBR_RS01690
MSDDKAAATAEVLDRLYATVQARKGADPETSYTAKLFHRGTAKIAQKVGEEAVETVIEAV
RGDKAAVASESADLLYHLMVLWADAGLEPAAVWEKLAQREGTSGIAEKNARKA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory