Comparing AZOBR_RS01990 FitnessBrowser__azobra:AZOBR_RS01990 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 12 hits to proteins with known functional sites (download)
Q7ZVE3 Fructose-2,6-bisphosphatase TIGAR B; TP53-induced glycolysis and apoptosis regulator B; EC 3.1.3.46 from Danio rerio (Zebrafish) (Brachydanio rerio) (see paper)
33% identity, 65% coverage: 4:130/194 of query aligns to 6:139/257 of Q7ZVE3
Q9MB58 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase; 6PF-2-K/Fru-2,6-P2ase; AtF2KP; PFK/FBPase; EC 2.7.1.105; EC 3.1.3.46 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
28% identity, 76% coverage: 4:151/194 of query aligns to 553:705/744 of Q9MB58
Sites not aligning to the query:
1h2fA Bacillus stearothermophilus phoe (previously known as yhfr) in complex with trivanadate (see paper)
30% identity, 77% coverage: 2:151/194 of query aligns to 2:159/207 of 1h2fA
Sites not aligning to the query:
1h2eA Bacillus stearothermophilus phoe (previously known as yhfr) in complex with phosphate (see paper)
30% identity, 77% coverage: 2:151/194 of query aligns to 2:159/207 of 1h2eA
P9WIC7 Glucosyl-3-phosphoglycerate phosphatase; Mannosyl-3-phosphoglycerate phosphatase; EC 3.1.3.85; EC 3.1.3.70 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
35% identity, 73% coverage: 4:144/194 of query aligns to 6:161/223 of P9WIC7
Sites not aligning to the query:
4qihA The structure of mycobacterial glucosyl-3-phosphoglycerate phosphatase rv2419c complexes with vo3 (see paper)
35% identity, 73% coverage: 4:144/194 of query aligns to 4:159/209 of 4qihA
4pzaB The complex structure of mycobacterial glucosyl-3-phosphoglycerate phosphatase rv2419c with inorganic phosphate (see paper)
35% identity, 73% coverage: 4:144/194 of query aligns to 5:160/217 of 4pzaB
5htkA Human heart 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase (pfkfb2) (see paper)
29% identity, 79% coverage: 4:157/194 of query aligns to 222:378/425 of 5htkA
Sites not aligning to the query:
O60825 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2; 6PF-2-K/Fru-2,6-P2ase 2; PFK/FBPase 2; 6PF-2-K/Fru-2,6-P2ase heart-type isozyme; EC 2.7.1.105; EC 3.1.3.46 from Homo sapiens (Human) (see 2 papers)
29% identity, 79% coverage: 4:157/194 of query aligns to 252:408/505 of O60825
Sites not aligning to the query:
6m1xC Crystal structure of phosphoserine phosphatase in complex with 3- phosphoglyceric acid from entamoeba histolytica (see paper)
35% identity, 47% coverage: 1:92/194 of query aligns to 1:94/196 of 6m1xC
Sites not aligning to the query:
P36623 Phosphoglycerate mutase; PGAM; BPG-dependent PGAM; MPGM; Phosphoglyceromutase; EC 5.4.2.11 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
25% identity, 75% coverage: 4:149/194 of query aligns to 10:170/211 of P36623
P9WIC9 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase; BPG-dependent PGAM; PGAM; Phosphoglyceromutase; dPGM; EC 5.4.2.11 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
29% identity, 75% coverage: 4:149/194 of query aligns to 7:190/249 of P9WIC9
>AZOBR_RS01990 FitnessBrowser__azobra:AZOBR_RS01990
MTDLIILRHGPTAWNAAHRLQGGIDEPLSDEGRARVATWRLPPDVLDYRWVASPKRRAWE
TARLLGLDPAPEPRLVEMGWGEWEGRLLEELRSSGALTADRERMGLDFRAPGGESPRDVQ
SRLIPWLAEVGAGGVPTGAVAHNGVMRALYALATGWDMVGKPAHRLTDGCAHRFRVAEDG
APSVVAMNVPLTER
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory