Comparing AZOBR_RS02010 FitnessBrowser__azobra:AZOBR_RS02010 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 9 hits to proteins with known functional sites (download)
7d50B Spua mutant - h221n with glutamyl-thioester (see paper)
61% identity, 99% coverage: 1:251/253 of query aligns to 6:255/255 of 7d50B
7d53A Spua mutant - h221n with glu (see paper)
60% identity, 99% coverage: 2:251/253 of query aligns to 1:249/249 of 7d53A
7d4rB Spua native structure (see paper)
52% identity, 96% coverage: 5:248/253 of query aligns to 2:214/215 of 7d4rB
P76038 Gamma-glutamyl-gamma-aminobutyrate hydrolase PuuD; Gamma-Glu-GABA hydrolase; EC 3.5.1.94 from Escherichia coli (strain K12) (see paper)
44% identity, 96% coverage: 3:244/253 of query aligns to 6:244/254 of P76038
6vtvB Crystal structure of puud gamma-glutamyl-gamma-aminobutyrate hydrolase from e. Coli
44% identity, 96% coverage: 3:244/253 of query aligns to 4:242/252 of 6vtvB
3fijA Crystal structure of a uncharacterized protein lin1909
33% identity, 98% coverage: 4:252/253 of query aligns to 2:224/224 of 3fijA
O33341 Putative glutamine amidotransferase Rv2859c; EC 2.4.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
38% identity, 85% coverage: 36:249/253 of query aligns to 100:304/308 of O33341
P49915 GMP synthase [glutamine-hydrolyzing]; GMP synthetase; Glutamine amidotransferase; EC 6.3.5.2 from Homo sapiens (Human) (see paper)
30% identity, 55% coverage: 101:240/253 of query aligns to 92:206/693 of P49915
Sites not aligning to the query:
2vxoB Human gmp synthetase in complex with xmp (see paper)
29% identity, 55% coverage: 101:240/253 of query aligns to 70:181/658 of 2vxoB
Sites not aligning to the query:
>AZOBR_RS02010 FitnessBrowser__azobra:AZOBR_RS02010
MNRKPLIGVPACARMMGEHPFHVVGDKYVRAVSDGAGGMPLLIPALGTALDMDDVAGRLD
GLLVTGSPSNVEPHRYGGSPSEPGTLHDPERDDTTLPLIRAALEMGVPLLGICRGFQELN
VALGGTLHQRVHEVPGYANHREDKEAPLAVQYGPSHSVRLTPGGVLERLAGGAAAVTVNS
LHGQGVDRLADGLIVEAMAEDGLVEAVRVAGAPAFALAVQWHPEWRFWENPLSAAILRAF
GSAAADRARRRLS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory