SitesBLAST
Comparing AZOBR_RS02035 FitnessBrowser__azobra:AZOBR_RS02035 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5u2wA Crystal structure of a short chain dehydrogenase from burkholderia cenocepacia j2315 in complex with NADP
63% identity, 98% coverage: 7:250/250 of query aligns to 3:246/246 of 5u2wA
- active site: G17 (= G21), S141 (= S145), M152 (≠ V156), Y155 (= Y159), K159 (= K163)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G17), S15 (= S19), R16 (= R20), G17 (= G21), I18 (= I22), Y37 (= Y41), E38 (= E42), K39 (≠ R43), S40 (= S44), A63 (= A67), D64 (= D68), S65 (= S69), N91 (= N95), A92 (= A96), G93 (= G97), T139 (≠ I143), Y155 (= Y159), K159 (= K163), P185 (= P189), G186 (= G190), T188 (= T192), T190 (= T194), M192 (= M196), N193 (= N197)
5wuwA Serratia marcescens short-chain dehydrogenase/reductase f98l/f202l mutant (see paper)
50% identity, 97% coverage: 8:250/250 of query aligns to 3:245/245 of 5wuwA
- active site: G16 (= G21), S140 (= S145), Y154 (= Y159), L161 (≠ Q166)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G17), R15 (= R20), I17 (= I22), Y36 (= Y41), A37 (≠ E42), A38 (≠ R43), D63 (= D68), S64 (= S69), N90 (= N95), A91 (= A96), G92 (= G97), Y154 (= Y159), K158 (= K163), G185 (= G190), P186 (≠ A191), V187 (≠ T192)
6j7uA Crystal structure of blue fluorescent protein from metagenomic library in complex with NADPH (see paper)
51% identity, 98% coverage: 7:250/250 of query aligns to 2:247/247 of 6j7uA
- active site: G16 (= G21), S142 (= S145), Y156 (= Y159)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G12 (= G17), S14 (= S19), R15 (= R20), I17 (= I22), Y36 (= Y41), V37 (≠ E42), S38 (≠ R43), S41 (≠ E46), D65 (= D68), S66 (= S69), N92 (= N95), A93 (= A96), G94 (= G97), I115 (≠ V118), G141 (= G144), S142 (= S145), Y156 (= Y159), K160 (= K163), P186 (= P189), T191 (= T194), M193 (= M196), N194 (= N197)
P39333 Cyclic-di-GMP-binding biofilm dispersal mediator protein from Escherichia coli (strain K12) (see paper)
42% identity, 98% coverage: 6:250/250 of query aligns to 2:237/237 of P39333
- E50 (≠ G59) mutation E->Q,V: Shows higher affinity for cyclic-di-GMP, increases swimming motility and biofilm dispersal. Biofilm formation is almost completely removed.
5z2lK Crystal structure of bdca in complex with NADPH (see paper)
42% identity, 98% coverage: 6:250/250 of query aligns to 1:236/244 of 5z2lK
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: S14 (= S19), R15 (= R20), I17 (= I22), Y36 (= Y41), A37 (≠ E42), G38 (≠ R43), S39 (= S44), T57 (≠ A67), D58 (= D68), S59 (= S69), N81 (= N95), A82 (= A96), G83 (= G97), I129 (= I143), S131 (= S145), Y145 (= Y159), K149 (= K163), P175 (= P189), I178 (≠ T192), T180 (= T194), A182 (≠ M196), N183 (= N197)
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
42% identity, 95% coverage: 11:248/250 of query aligns to 5:244/246 of 3osuA
3sj7A Structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with NADPH (see paper)
42% identity, 95% coverage: 11:248/250 of query aligns to 2:237/239 of 3sj7A
- active site: G12 (= G21), S138 (= S145), Q148 (≠ V156), Y151 (= Y159), K155 (= K163)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G17), S10 (= S19), R11 (= R20), I13 (= I22), N31 (≠ S40), Y32 (= Y41), A33 (≠ E42), G34 (≠ R43), S35 (= S44), A58 (= A67), N59 (≠ D68), V60 (≠ S69), N86 (= N95), A87 (= A96), T109 (≠ V118), S138 (= S145), Y151 (= Y159), K155 (= K163), P181 (= P189), G182 (= G190)
7v0hG Crystal structure of putative glucose 1-dehydrogenase from burkholderia cenocepacia in complex with NADP and a potential reaction product
43% identity, 97% coverage: 7:249/250 of query aligns to 8:253/253 of 7v0hG
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G17), S20 (= S19), K21 (≠ R20), G22 (= G21), I23 (= I22), A43 (≠ E42), S44 (≠ R43), S45 (= S44), G68 (≠ A67), D69 (= D68), V70 (≠ S69), N96 (= N95), S97 (≠ A96), G98 (= G97), Y100 (≠ A99), I144 (= I143), S146 (= S145), Y159 (= Y159), K163 (= K163), P189 (= P189), G190 (= G190), M191 (≠ A191), I192 (≠ T192), T194 (= T194), G196 (≠ M196), T197 (≠ N197)
- binding (2R)-2-(hydroxymethyl)pentanedioic acid: S146 (= S145), Y159 (= Y159), M191 (≠ A191), I202 (≠ A202)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
40% identity, 96% coverage: 8:248/250 of query aligns to 3:245/247 of 4jroC
- active site: G16 (= G21), S142 (= S145), Q152 (≠ V156), Y155 (= Y159), K159 (= K163)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G17), S14 (= S19), R15 (= R20), G16 (= G21), I17 (= I22), N35 (≠ S40), Y36 (= Y41), N37 (≠ E42), G38 (≠ R43), S39 (= S44), N63 (≠ D68), V64 (≠ S69), N90 (= N95), A91 (= A96), I93 (= I98), I113 (≠ V118), S142 (= S145), Y155 (= Y159), K159 (= K163), P185 (= P189), I188 (≠ T192), T190 (= T194)
4fj1B Crystal structure of the ternary complex between a fungal 17beta- hydroxysteroid dehydrogenase (holo form) and genistein (see paper)
37% identity, 97% coverage: 6:247/250 of query aligns to 3:257/259 of 4fj1B
- active site: G18 (= G21), S142 (= S145), N143 (≠ C146), H153 (≠ V156), Y156 (= Y159), K160 (= K163), Y201 (vs. gap)
- binding genistein: G188 (≠ A191), F194 (≠ N197), S198 (vs. gap), Y201 (vs. gap), I202 (vs. gap), M216 (vs. gap), A217 (vs. gap)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G14 (= G17), R17 (= R20), G18 (= G21), I19 (= I22), A39 (≠ E42), N40 (≠ R43), S41 (= S44), I66 (≠ S69), N92 (= N95), S93 (≠ A96), G94 (= G97), L115 (≠ V118), T140 (≠ I143), S142 (= S145), Y156 (= Y159), K160 (= K163), G187 (= G190), T189 (= T192), T191 (= T194), M193 (= M196)
4fj0D Crystal structure of the ternary complex between a fungal 17beta- hydroxysteroid dehydrogenase (holo form) and 3,7-dihydroxy flavone (see paper)
37% identity, 97% coverage: 6:247/250 of query aligns to 5:259/261 of 4fj0D
- active site: G20 (= G21), S144 (= S145), N145 (≠ C146), H155 (≠ V156), Y158 (= Y159), K162 (= K163), Y203 (vs. gap)
- binding 3,7-dihydroxy-2-phenyl-4H-chromen-4-one: S144 (= S145), N145 (≠ C146), G190 (≠ A191), F196 (≠ N197), S200 (vs. gap), Y203 (vs. gap), A219 (vs. gap)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G16 (= G17), R19 (= R20), G20 (= G21), I21 (= I22), A41 (≠ E42), N42 (≠ R43), S43 (= S44), I68 (≠ S69), N94 (= N95), S95 (≠ A96), G96 (= G97), L117 (≠ V118), T142 (≠ I143), Y158 (= Y159), K162 (= K163), P188 (= P189), G189 (= G190), G190 (≠ A191), T191 (= T192), T193 (= T194), M195 (= M196)
4fj2B Crystal structure of the ternary complex between a fungal 17beta- hydroxysteroid dehydrogenase (holo form) and biochanin a (see paper)
37% identity, 97% coverage: 6:247/250 of query aligns to 4:258/260 of 4fj2B
- active site: G19 (= G21), S143 (= S145), N144 (≠ C146), H154 (≠ V156), Y157 (= Y159), K161 (= K163), Y202 (vs. gap)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G17), R18 (= R20), G19 (= G21), I20 (= I22), A40 (≠ E42), N41 (≠ R43), S42 (= S44), I67 (≠ S69), N93 (= N95), S94 (≠ A96), G95 (= G97), L116 (≠ V118), T141 (≠ I143), Y157 (= Y159), K161 (= K163), G188 (= G190), G189 (≠ A191), T190 (= T192), T192 (= T194), M194 (= M196)
- binding 5,7-dihydroxy-3-(4-methoxyphenyl)-4H-chromen-4-one: G189 (≠ A191), F195 (≠ N197), V198 (vs. gap), S199 (vs. gap), Y202 (vs. gap), I203 (vs. gap), M217 (vs. gap), A218 (vs. gap)
3qwiA Crystal structure of a 17beta-hydroxysteroid dehydrogenase (holo form) from fungus cochliobolus lunatus in complex with NADPH and coumestrol (see paper)
37% identity, 97% coverage: 6:247/250 of query aligns to 4:258/260 of 3qwiA
- active site: G19 (= G21), S143 (= S145), N144 (≠ C146), H154 (≠ V156), Y157 (= Y159), K161 (= K163), Y202 (vs. gap)
- binding Coumestrol: F149 (≠ I151), G189 (≠ A191), M194 (= M196), Y202 (vs. gap), I203 (vs. gap), A218 (vs. gap)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G17), R18 (= R20), I20 (= I22), A40 (≠ E42), N41 (≠ R43), S42 (= S44), I67 (≠ S69), N93 (= N95), S94 (≠ A96), G95 (= G97), L116 (≠ V118), T141 (≠ I143), Y157 (= Y159), K161 (= K163), P187 (= P189), G188 (= G190), G189 (≠ A191), T190 (= T192), T192 (= T194), M194 (= M196)
3qwhA Crystal structure of the 17beta-hydroxysteroid dehydrogenase from cochliobolus lunatus in complex with NADPH and kaempferol (see paper)
37% identity, 97% coverage: 6:247/250 of query aligns to 4:258/260 of 3qwhA
- active site: G19 (= G21), S143 (= S145), N144 (≠ C146), H154 (≠ V156), Y157 (= Y159), K161 (= K163), Y202 (vs. gap)
- binding 3,5,7-trihydroxy-2-(4-hydroxyphenyl)-4h-chromen-4-one: N144 (≠ C146), F149 (≠ I151), G189 (≠ A191), F195 (≠ N197), S199 (vs. gap), Y202 (vs. gap), I203 (vs. gap), A218 (vs. gap)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G17), R18 (= R20), G19 (= G21), I20 (= I22), A40 (≠ E42), N41 (≠ R43), S42 (= S44), D66 (= D68), I67 (≠ S69), N93 (= N95), S94 (≠ A96), G95 (= G97), L116 (≠ V118), T141 (≠ I143), Y157 (= Y159), K161 (= K163), P187 (= P189), G188 (= G190), G189 (≠ A191), T190 (= T192), T192 (= T194), M194 (= M196)
3iccA Crystal structure of a putative 3-oxoacyl-(acyl carrier protein) reductase from bacillus anthracis at 1.87 a resolution (see paper)
40% identity, 96% coverage: 8:247/250 of query aligns to 5:252/255 of 3iccA
- active site: G18 (= G21), S148 (= S145), F158 (≠ V156), Y161 (= Y159), K165 (= K163)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G14 (= G17), S16 (= S19), R17 (= R20), G18 (= G21), I19 (= I22), H37 (≠ S40), Y38 (= Y41), G39 (≠ E42), L66 (≠ S69), E67 (≠ A70), N98 (= N95), G100 (= G97), I146 (= I143), S148 (= S145), Y161 (= Y159), K165 (= K163), P191 (= P189), G192 (= G190), M198 (= M196), N199 (= N197)
7nm8AAA Antimycin pathway standalone ketoreductase, AntM (see paper)
42% identity, 96% coverage: 10:248/250 of query aligns to 6:248/251 of 7nm8AAA
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G13 (= G17), S15 (= S19), R16 (= R20), G17 (= G21), I18 (= I22), H36 (≠ S40), Y37 (= Y41), G38 (≠ E42), H39 (≠ R43), L65 (≠ S69), N97 (= N95), G99 (= G97), S147 (= S145), Y160 (= Y159), K164 (= K163), G191 (= G190), T193 (= T192), T195 (= T194)
5jydB Crystal structure of a putative short chain dehydrogenase from burkholderia cenocepacia
43% identity, 97% coverage: 6:248/250 of query aligns to 43:289/292 of 5jydB
- active site: G58 (= G21), S184 (= S145), L194 (≠ V156), Y197 (= Y159), K201 (= K163), P242 (≠ A204)
- binding magnesium ion: D56 (≠ S19), S57 (≠ R20), E82 (≠ A45)
- binding nicotinamide-adenine-dinucleotide: G54 (= G17), D56 (≠ S19), S57 (≠ R20), G58 (= G21), I59 (= I22), L79 (≠ E42), E82 (≠ A45), D106 (= D68), I107 (≠ S69), N133 (= N95), A134 (= A96), A135 (= A99), T182 (≠ I143), S184 (= S145), Y197 (= Y159), K201 (= K163), P227 (= P189), G228 (= G190), P229 (≠ A191), Y230 (≠ T192), T232 (= T194), L234 (≠ M196), Q235 (≠ N197)
8hfjC Crystal structure of cbar mutant (h162f) in complex with NADP+ and a bulky 1,3-cyclodiketone (see paper)
36% identity, 97% coverage: 6:247/250 of query aligns to 4:258/260 of 8hfjC
- binding 2-methyl-2-[(4-methylphenyl)methyl]cyclopentane-1,3-dione: N144 (≠ C146), T145 (≠ L147), F154 (≠ V156), G189 (≠ A191), V198 (≠ D200)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G17), R18 (= R20), I20 (= I22), Y39 (= Y41), A40 (≠ E42), N41 (≠ R43), S42 (= S44), D66 (= D68), V67 (≠ S69), N93 (= N95), S94 (≠ A96), L116 (≠ V118), T141 (≠ I143), Y157 (= Y159), K161 (= K163), P187 (= P189), T190 (= T192), T192 (= T194), M194 (= M196)
Sites not aligning to the query:
7yb2D Crystal structure of anthrol reductase (cbar) in complex with NADP+ and emodin (see paper)
36% identity, 97% coverage: 6:247/250 of query aligns to 8:262/264 of 7yb2D
- binding 3-methyl-1,6,8-trihydroxyanthraquinone: S147 (= S145), Y161 (= Y159), G193 (≠ A191), M198 (= M196), F199 (≠ N197), V202 (≠ D200), S203 (≠ G201), Y206 (vs. gap)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G19 (= G17), R22 (= R20), G23 (= G21), I24 (= I22), Y43 (= Y41), A44 (≠ E42), N45 (≠ R43), S46 (= S44), D70 (= D68), V71 (≠ S69), N97 (= N95), S98 (≠ A96), L120 (≠ V118), T145 (≠ I143), S147 (= S145), Y161 (= Y159), K165 (= K163), P191 (= P189), G192 (= G190), T194 (= T192), T196 (= T194), M198 (= M196)
8hfkA Crystal structure of cbar mutant (h162f) in complex with NADP+ and halogenated aryl ketone (see paper)
37% identity, 97% coverage: 6:247/250 of query aligns to 4:257/259 of 8hfkA
- binding 2-bromanyl-1-(4-bromanyl-2-oxidanyl-phenyl)ethanone: S143 (= S145), N144 (≠ C146), T145 (≠ L147), F153 (≠ V156), Y156 (= Y159), G187 (= G190), M193 (= M196), V197 (≠ D200)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G17), R18 (= R20), I20 (= I22), A40 (≠ E42), N41 (≠ R43), S42 (= S44), D66 (= D68), N93 (= N95), S94 (≠ A96), L116 (≠ V118), T141 (≠ I143), Y156 (= Y159), K160 (= K163), P186 (= P189), G187 (= G190), G188 (≠ A191), T189 (= T192), T191 (= T194), M193 (= M196)
Sites not aligning to the query:
Query Sequence
>AZOBR_RS02035 FitnessBrowser__azobra:AZOBR_RS02035
MVEPSGELVGKRALVTGGSRGIGAAIALALADKGADVAISYERSAERAAEVVRAIEAKGR
RAVAIQADSADPSAMAALVGRTVEALGGLDILVNNAGIARQGMVAEMSLADIDALLNVNV
RAAVLVAQAAIPHLKDGGRIVFIGSCLADRITAPGVTIYSMTKSAQTALTHGLARELGPR
DITVNLVQPGATNTDMNPADGAHAEILRSQTPLGRYGQPEDVAAAVAFLASPAARQISGA
TLTVDGGLNA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory