Comparing AZOBR_RS02295 FitnessBrowser__azobra:AZOBR_RS02295 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3jtxB Crystal structure of aminotransferase (np_283882.1) from neisseria meningitidis z2491 at 1.91 a resolution
42% identity, 97% coverage: 12:408/410 of query aligns to 1:391/393 of 3jtxB
2x5dD Crystal structure of a probable aminotransferase from pseudomonas aeruginosa (see paper)
26% identity, 92% coverage: 27:405/410 of query aligns to 4:371/380 of 2x5dD
6l1nA Substrate bound bacf structure from bacillus subtillis (see paper)
27% identity, 96% coverage: 17:408/410 of query aligns to 7:386/393 of 6l1nA
6l1lB Apo-bacf structure from bacillus subtillis (see paper)
27% identity, 91% coverage: 37:408/410 of query aligns to 29:387/393 of 6l1lB
6l1oB Product bound bacf structure from bacillus subtillis (see paper)
27% identity, 91% coverage: 37:408/410 of query aligns to 29:387/392 of 6l1oB
Sites not aligning to the query:
2o1bA Structure of aminotransferase from staphylococcus aureus
28% identity, 89% coverage: 43:408/410 of query aligns to 22:371/376 of 2o1bA
1v2fA Crystal structure of t.Th hb8 glutamine aminotransferase complex with 3-phenylpropionate (see paper)
30% identity, 92% coverage: 31:409/410 of query aligns to 18:368/368 of 1v2fA
Sites not aligning to the query:
1v2eA Crystal structure of t.Th hb8 glutamine aminotransferase complex with a-keto-g-methylthiobutyrate (see paper)
30% identity, 92% coverage: 31:409/410 of query aligns to 18:368/368 of 1v2eA
Sites not aligning to the query:
1gdeA Crystal structure of pyrococcus protein a-1 e-form (see paper)
24% identity, 97% coverage: 12:409/410 of query aligns to 2:382/388 of 1gdeA
1gd9A Crystall structure of pyrococcus protein-a1 (see paper)
24% identity, 97% coverage: 12:409/410 of query aligns to 2:382/388 of 1gd9A
P14909 Aspartate aminotransferase; AspAT; Transaminase A; EC 2.6.1.1 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see 3 papers)
23% identity, 81% coverage: 72:405/410 of query aligns to 68:391/402 of P14909
Sites not aligning to the query:
1o4sB Crystal structure of aspartate aminotransferase (tm1255) from thermotoga maritima at 1.90 a resolution (see paper)
22% identity, 96% coverage: 18:410/410 of query aligns to 13:383/384 of 1o4sB
1j32A Aspartate aminotransferase from phormidium lapideum
25% identity, 89% coverage: 46:409/410 of query aligns to 36:384/388 of 1j32A
5wmiA Arabidopsis thaliana prephenate aminotransferase mutant- t84v (see paper)
27% identity, 79% coverage: 24:347/410 of query aligns to 18:329/402 of 5wmiA
Sites not aligning to the query:
5wmhA Arabidopsis thaliana prephenate aminotransferase (see paper)
27% identity, 74% coverage: 43:347/410 of query aligns to 32:329/399 of 5wmhA
5wmlA Arabidopsis thaliana prephenate aminotransferase mutant- k306a (see paper)
27% identity, 74% coverage: 43:347/410 of query aligns to 33:330/404 of 5wmlA
Sites not aligning to the query:
Q56232 Aspartate/prephenate aminotransferase; AspAT / PAT; Transaminase A; EC 2.6.1.1; EC 2.6.1.78 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see 3 papers)
26% identity, 91% coverage: 37:410/410 of query aligns to 28:383/385 of Q56232
Sites not aligning to the query:
1bkgA Aspartate aminotransferase from thermus thermophilus with maleate (see paper)
25% identity, 91% coverage: 37:409/410 of query aligns to 28:382/382 of 1bkgA
1bjwA Aspartate aminotransferase from thermus thermophilus (see paper)
25% identity, 91% coverage: 37:409/410 of query aligns to 28:382/382 of 1bjwA
1b5oA Thermus thermophilus aspartate aminotransferase single mutant 1 (see paper)
26% identity, 91% coverage: 37:409/410 of query aligns to 28:382/382 of 1b5oA
>AZOBR_RS02295 FitnessBrowser__azobra:AZOBR_RS02295
MSLPDLGTFALVNDRLDRLSDYPFTRLAALLSGVTPRANAEPIMMSVGEPQHQPPAIIDE
TLRANAHLWGKYPPVGGTPEFREAVGAWLARRYALPDGLFDAEKSVLPVSGTREALFLLA
LLAVPPSKAGRQPAVLMPNPFYAPYEGAALLAGAEPVFLPSTRETGFLPDLDALTPELLE
RTALFYLCTPANPQGAAADAAYLERAIGLARRYGFILAVDECYAEIYLDKPPVGALQVAS
GLDHGGKPWANILVFHSLSKRSSAAGLRSGFVAGDPELMSRFTRLRSYSNAGMPLPVLAA
SAALWRDEAHVEENRALYRAKFDAAEASLKGRYGYYRPDGGFFLWLEVGDGEEATRRLWA
EGGIRVLPGAYLTRCNPGEANPGAPFIRIALVNDAETVAHACSTIARILG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory