Comparing AZOBR_RS02715 FitnessBrowser__azobra:AZOBR_RS02715 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4p8bA Crystal structure of a trap periplasmic solute binding protein from ralstonia eutropha h16 (h16_a1328), target efi-510189, with bound (s)-2-hydroxy-2-methyl-3-oxobutanoate ((s)-2-acetolactate) (see paper)
68% identity, 92% coverage: 28:341/342 of query aligns to 1:314/314 of 4p8bA
4pdhA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp js666 (bpro_1871, target efi-510164) bound to d- erythronate (see paper)
34% identity, 79% coverage: 33:301/342 of query aligns to 5:266/301 of 4pdhA
7bcrA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with galactonate (see paper)
31% identity, 85% coverage: 43:332/342 of query aligns to 18:300/310 of 7bcrA
Sites not aligning to the query:
7bcpA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with gluconate (see paper)
31% identity, 85% coverage: 43:332/342 of query aligns to 18:300/310 of 7bcpA
Sites not aligning to the query:
7bcoA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with d-foconate (see paper)
31% identity, 85% coverage: 43:332/342 of query aligns to 18:300/310 of 7bcoA
Sites not aligning to the query:
7bcnA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with xylonic acid (see paper)
31% identity, 85% coverage: 43:332/342 of query aligns to 18:300/310 of 7bcnA
7bbrA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t (see paper)
31% identity, 85% coverage: 43:332/342 of query aligns to 19:301/310 of 7bbrA
Sites not aligning to the query:
4p9kA Crystal structure of a trap periplasmic solute binding protein from verminephrobacter eiseniae ef01-2 (veis_3954, target efi-510324) a nephridial symbiont of the earthworm eisenia foetida, bound to d- erythronate with residual density suggestive of superposition with copurified alternative ligand. (see paper)
34% identity, 75% coverage: 45:301/342 of query aligns to 19:268/303 of 4p9kA
Sites not aligning to the query:
4pakA Crystal structure of a trap periplasmic solute binding protein from verminephrobacter eiseniae ef01-2 (veis_3954, target efi-510324) a nephridial symbiont of the earthworm eisenia foetida, bound to (r)- pantoic acid (see paper)
34% identity, 75% coverage: 45:301/342 of query aligns to 20:269/304 of 4pakA
Sites not aligning to the query:
4nq8B Crystal structure of a trap periplasmic solute binding protein from bordetella bronchispeptica (bb3421), target efi-510039, with density modeled as pantoate (see paper)
33% identity, 70% coverage: 33:271/342 of query aligns to 5:240/301 of 4nq8B
4pddA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp js666 (bpro_0088, target efi-510167) bound to d- erythronate (see paper)
30% identity, 85% coverage: 44:335/342 of query aligns to 16:298/303 of 4pddA
Sites not aligning to the query:
4p3lA Crystal structure of a trap periplasmic solute binding protein from chromohalobacter salexigens dsm 3043 (csal_2479), target efi-510085, with bound glucuronate, spg p6122 (see paper)
30% identity, 83% coverage: 42:324/342 of query aligns to 13:286/303 of 4p3lA
Sites not aligning to the query:
4x8rA Crystal structure of a trap periplasmic solute binding protein from rhodobacter sphaeroides (rsph17029_2138, target efi-510205) with bound glucuronate
34% identity, 85% coverage: 42:332/342 of query aligns to 16:298/304 of 4x8rA
Sites not aligning to the query:
4xeqB Crystal structure of a trap periplasmic solute binding protein from desulfovibrio vulgaris (deval_0042, target efi-510114) bound to copurified (r)-pantoic acid
32% identity, 75% coverage: 46:302/342 of query aligns to 18:266/304 of 4xeqB
Sites not aligning to the query:
4xfeA Crystal structure of a trap periplasmic solute binding protein from pseudomonas putida f1 (pput_1203), target efi-500184, with bound d- glucuronate
30% identity, 85% coverage: 42:332/342 of query aligns to 13:293/306 of 4xfeA
Sites not aligning to the query:
4n8yA Crystal structure of a trap periplasmic solute binding protein from bradyrhizobium sp. Btai1 b (bbta_0128), target efi-510056 (bbta_0128), complex with alpha/beta-d-galacturonate (see paper)
33% identity, 77% coverage: 59:323/342 of query aligns to 30:285/300 of 4n8yA
Sites not aligning to the query:
4x04A Crystal structure of a trap periplasmic solute binding protein from citrobacter koseri (cko_04899, target efi-510094) with bound d- glucuronate
30% identity, 68% coverage: 42:274/342 of query aligns to 14:245/301 of 4x04A
Sites not aligning to the query:
Q0B2F6 Solute-binding protein Bamb_6123 from Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) (Burkholderia cepacia (strain AMMD)) (see paper)
28% identity, 86% coverage: 32:325/342 of query aligns to 29:314/328 of Q0B2F6
Q16BC9 Solute-binding protein RD1_1052 from Roseobacter denitrificans (strain ATCC 33942 / OCh 114) (Erythrobacter sp. (strain OCh 114)) (Roseobacter denitrificans) (see paper)
29% identity, 76% coverage: 33:291/342 of query aligns to 32:285/325 of Q16BC9
4n17A Crystal structure of a trap periplasmic solute binding protein from burkholderia ambifaria (bam_6123), target efi-510059, with bound beta-d-galacturonate (see paper)
28% identity, 86% coverage: 32:325/342 of query aligns to 3:288/301 of 4n17A
>AZOBR_RS02715 FitnessBrowser__azobra:AZOBR_RS02715
MKALFAGLALAAMVLPGVVANGAAAADYKAEYKLSTVLGKPFPWGIGGDRWAELVKEKTN
GRINVKMYPGSALVNGDQTKEFTALRQGVIDMAVGSTINWSPQVKELNLFSLPFLMPDHK
AMDALTQGPVGKQLFDLLATKDVVPLAWGENGFREVSNSKHAISKPEDLKGLKIRVVGSP
LYLDTFTALGANPTQMSWADAQPALSTGAVDGQENPVAVFTAAKLPTLGQKHLTLWGYVA
DPLIFVVNKEVWNSWSKEDQEAVRAAAVQAAAEEVAIARKGITAQDDSLLKELAGQGVAV
VQLTPEQQKAFQAATRAVYDKWAKTIGPDLVKAAETSVAGRN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory