SitesBLAST
Comparing AZOBR_RS03090 FitnessBrowser__azobra:AZOBR_RS03090 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9R4E4 3-phosphoshikimate 1-carboxyvinyltransferase; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EPSPS; EC 2.5.1.19 from Agrobacterium sp. (strain CP4) (see 2 papers)
57% identity, 99% coverage: 3:442/445 of query aligns to 6:447/455 of Q9R4E4
- KS 28:29 (= KS 25:26) binding
- R33 (= R30) binding
- NAAT 98:101 (≠ NSGT 96:99) Phosphoenolpyruvate
- A100 (≠ G98) mutation to G: Confers resistance to glyphosate.
- R128 (= R126) binding
- K353 (= K351) binding
- R357 (= R355) binding
- R405 (= R400) binding
2pqcA Cp4 epsps liganded with (r)-phosphonate tetrahedral reaction intermediate analog (see paper)
57% identity, 99% coverage: 3:442/445 of query aligns to 1:442/445 of 2pqcA
- active site: K23 (= K25), S24 (= S26), D50 (= D52), N93 (= N96), R123 (= R126), D321 (= D324), E349 (= E352), H399 (= H399), R400 (= R400), T426 (= T426)
- binding [3r-[3a,4a,5b(r*)]]-5-(1-carboxy-1-phosphonoethoxy)-4-hydroxy-3-(phosphonooxy)-1-cyclohexene-1-carboxylic acid: K23 (= K25), S24 (= S26), R28 (= R30), T96 (= T99), R123 (= R126), S168 (= S171), Q170 (= Q173), D321 (= D324), K348 (= K351), E349 (= E352), R352 (= R355), R400 (= R400)
2pqbA Cp4 epsps liganded with (r)-difluoromethyl tetrahedral intermediate analog (see paper)
57% identity, 99% coverage: 3:442/445 of query aligns to 1:442/445 of 2pqbA
- active site: K23 (= K25), S24 (= S26), D50 (= D52), N93 (= N96), R123 (= R126), D321 (= D324), E349 (= E352), H399 (= H399), R400 (= R400), T426 (= T426)
- binding (3r,4s,5r)-5-[(1r)-1-carboxy-2,2-difluoro-1-(phosphonooxy)ethoxy]-4-hydroxy-3-(phosphonooxy)cyclohex-1-ene-1-carboxylic acid: K23 (= K25), S24 (= S26), R28 (= R30), A95 (≠ G98), T96 (= T99), R123 (= R126), S168 (= S171), Q170 (= Q173), D321 (= D324), K348 (= K351), E349 (= E352), R352 (= R355), R400 (= R400)
2ggaA Cp4 epsp synthase liganded with s3p and glyphosate (see paper)
57% identity, 99% coverage: 3:442/445 of query aligns to 1:442/445 of 2ggaA
- active site: K23 (= K25), S24 (= S26), D50 (= D52), N93 (= N96), R123 (= R126), D321 (= D324), E349 (= E352), H399 (= H399), R400 (= R400), T426 (= T426)
- binding glyphosate: K23 (= K25), A94 (≠ S97), A95 (≠ G98), T96 (= T99), R123 (= R126), D321 (= D324), E349 (= E352), R352 (= R355), R400 (= R400)
- binding shikimate-3-phosphate: S24 (= S26), R28 (= R30), S168 (= S171), A169 (= A172), Q170 (= Q173), R195 (= R198), D321 (= D324), K348 (= K351)
2gg6A Cp4 epsp synthase liganded with s3p (see paper)
57% identity, 99% coverage: 3:442/445 of query aligns to 1:442/445 of 2gg6A
- active site: K23 (= K25), S24 (= S26), D50 (= D52), N93 (= N96), R123 (= R126), D321 (= D324), E349 (= E352), H399 (= H399), R400 (= R400), T426 (= T426)
- binding shikimate-3-phosphate: S24 (= S26), R28 (= R30), T96 (= T99), S168 (= S171), Q170 (= Q173), D321 (= D324), K348 (= K351)
3slhD 1.70 angstrom resolution structure of 3-phosphoshikimate 1- carboxyvinyltransferase (aroa) from coxiella burnetii in complex with shikimate-3-phosphate and glyphosate
45% identity, 97% coverage: 15:444/445 of query aligns to 13:433/440 of 3slhD
- active site: K23 (= K25), S24 (= S26), D50 (= D52), N95 (= N96), R125 (= R126), D317 (= D324), E345 (= E352), H388 (= H399), R389 (= R400), T415 (= T426)
- binding glyphosate: K23 (= K25), G97 (= G98), T98 (= T99), R125 (= R126), Q171 (= Q173), D317 (= D324), E345 (= E352), R348 (= R355), H388 (= H399), R389 (= R400)
- binding shikimate-3-phosphate: S24 (= S26), R28 (= R30), S169 (= S171), Q171 (= Q173), R196 (= R198), D317 (= D324), K344 (= K351)
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: S24 (= S26), R28 (= R30), T98 (= T99), Q171 (= Q173), R196 (= R198), D317 (= D324), K344 (= K351)
Q83E11 3-phosphoshikimate 1-carboxyvinyltransferase; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EPSPS; EC 2.5.1.19 from Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
45% identity, 97% coverage: 15:444/445 of query aligns to 11:431/438 of Q83E11
- KS 21:22 (= KS 25:26) binding
- R26 (= R30) binding
- NSGT 93:96 (= NSGT 96:99) Phosphoenolpyruvate
- R123 (= R126) binding
- D315 (= D324) active site, Proton acceptor
- K342 (= K351) binding
- R346 (= R355) binding
- R387 (= R400) binding
4egrA 2.50 angstrom resolution structure of 3-phosphoshikimate 1- carboxyvinyltransferase (aroa) from coxiella burnetii in complex with phosphoenolpyruvate
45% identity, 97% coverage: 15:444/445 of query aligns to 13:429/434 of 4egrA
- active site: K23 (= K25), S24 (= S26), D50 (= D52), N95 (= N96), R125 (= R126), D313 (= D324), E341 (= E352), H384 (= H399), R385 (= R400), T411 (= T426)
- binding phosphoenolpyruvate: K23 (= K25), G97 (= G98), T98 (= T99), R125 (= R126), D313 (= D324), E341 (= E352), R344 (= R355), R385 (= R400)
Q9S400 3-phosphoshikimate 1-carboxyvinyltransferase; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EPSPS; EC 2.5.1.19 from Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) (see paper)
43% identity, 94% coverage: 15:431/445 of query aligns to 10:417/427 of Q9S400
1rf6A Structural studies of streptococcus pneumoniae epsp synthase in s3p- glp bound state (see paper)
43% identity, 94% coverage: 15:431/445 of query aligns to 10:417/427 of 1rf6A
- active site: K20 (= K25), S21 (= S26), D47 (= D52), N90 (= N96), D115 (≠ A121), R120 (= R126), D312 (= D324), E340 (= E352), H384 (= H399), R385 (= R400), T412 (= T426)
- binding glyphosate: K20 (= K25), G92 (= G98), T93 (= T99), R120 (= R126), Q168 (= Q173), D312 (= D324), E340 (= E352), R343 (= R355), H384 (= H399), R385 (= R400)
- binding shikimate-3-phosphate: S21 (= S26), R25 (= R30), S166 (= S171), Q168 (= Q173), R193 (= R198), I311 (= I323), D312 (= D324), K339 (= K351)
1rf4A Structural studies of streptococcus pneumoniae epsp synthase, tetrahedral intermediate bound state (see paper)
43% identity, 94% coverage: 15:431/445 of query aligns to 10:417/427 of 1rf4A
- active site: K20 (= K25), S21 (= S26), D47 (= D52), N90 (= N96), D115 (≠ A121), R120 (= R126), D312 (= D324), E340 (= E352), H384 (= H399), R385 (= R400), T412 (= T426)
- binding (3r,4s,5r)-5-{[(1r)-1-carboxy-2-fluoro-1-(phosphonooxy)ethyl]oxy}-4-hydroxy-3-(phosphonooxy)cyclohex-1-ene-1-carboxylic acid: K20 (= K25), S21 (= S26), R25 (= R30), G92 (= G98), T93 (= T99), R120 (= R126), S166 (= S171), A167 (= A172), Q168 (= Q173), R193 (= R198), D312 (= D324), K339 (= K351), E340 (= E352), R343 (= R355), H384 (= H399), R385 (= R400)
3nvsA 1.02 angstrom resolution crystal structure of 3-phosphoshikimate 1- carboxyvinyltransferase from vibrio cholerae in complex with shikimate-3-phosphate (partially photolyzed) and glyphosate
28% identity, 94% coverage: 15:432/445 of query aligns to 12:418/426 of 3nvsA
- active site: K22 (= K25), S23 (= S26), D49 (= D52), N94 (= N96), P119 (≠ A121), R124 (= R126), H128 (≠ R130), Q135 (= Q137), Y142 (≠ G144), E144 (≠ S146), A247 (= A246), A255 (≠ L254), D314 (= D324), E342 (= E352), H386 (= H399), R387 (= R400), K412 (≠ T426)
- binding glyphosate: K22 (= K25), G96 (= G98), R124 (= R126), Q172 (= Q173), D314 (= D324), E342 (= E352), R345 (= R355), H386 (= H399), R387 (= R400)
- binding magnesium ion: E123 (≠ K125), Q145 (≠ G147)
- binding shikimate-3-phosphate: K22 (= K25), S23 (= S26), R27 (= R30), T97 (= T99), S170 (= S171), S171 (≠ A172), Q172 (= Q173), S198 (≠ A194), Y201 (≠ T197), D314 (= D324), N337 (≠ E347), K341 (= K351)
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: S23 (= S26), R27 (= R30), Q172 (= Q173), Y201 (≠ T197), D314 (= D324), K341 (= K351)
Q9KRB0 3-phosphoshikimate 1-carboxyvinyltransferase; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EPSPS; EC 2.5.1.19 from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
28% identity, 94% coverage: 15:432/445 of query aligns to 12:418/426 of Q9KRB0
7tm6A Crystal structure of shikimate-3-phosphate and glyphosate bound 3- phosphoshikimate 1-carboxyvinyltransferase from klebsiella pneumoniae
29% identity, 93% coverage: 17:432/445 of query aligns to 13:416/426 of 7tm6A
- binding glyphosate: K21 (= K25), G95 (= G98), R123 (= R126), Q170 (≠ A172), D312 (= D324), E340 (= E352), R343 (= R355), H384 (= H399), R385 (= R400)
- binding shikimate-3-phosphate: S22 (= S26), R26 (= R30), T96 (= T99), S168 (≠ A170), S169 (= S171), Q170 (≠ A172), S196 (≠ A194), Y199 (≠ T197), D312 (= D324), N335 (≠ E347), K339 (= K351)
7tm5B Crystal structure of shikimate-3-phosphate bound 3-phosphoshikimate 1- carboxyvinyltransferase from klebsiella pneumoniae
29% identity, 93% coverage: 17:432/445 of query aligns to 14:417/427 of 7tm5B
- binding shikimate-3-phosphate: K22 (= K25), S23 (= S26), R27 (= R30), S169 (≠ A170), S170 (= S171), Q171 (≠ A172), S197 (≠ A194), Y200 (≠ T197), D313 (= D324), N336 (≠ E347), K340 (= K351)
2pq9A E. Coli epsps liganded with (r)-difluoromethyl tetrahedral reaction intermediate analog (see paper)
29% identity, 93% coverage: 17:432/445 of query aligns to 14:417/427 of 2pq9A
- active site: K22 (= K25), S23 (= S26), D49 (= D52), N94 (= N96), P119 (≠ A121), R124 (= R126), D313 (= D324), E341 (= E352), H385 (= H399), R386 (= R400), K411 (≠ T426)
- binding (3r,4s,5r)-5-[(1r)-1-carboxy-2,2-difluoro-1-(phosphonooxy)ethoxy]-4-hydroxy-3-(phosphonooxy)cyclohex-1-ene-1-carboxylic acid: K22 (= K25), S23 (= S26), R27 (= R30), G96 (= G98), T97 (= T99), R124 (= R126), S169 (≠ A170), S170 (= S171), Q171 (≠ A172), S197 (≠ A194), Y200 (≠ T197), D313 (= D324), N336 (≠ E347), K340 (= K351), R344 (= R355), H385 (= H399), R386 (= R400), K411 (≠ T426)
2aa9A Epsp synthase liganded with shikimate (see paper)
29% identity, 93% coverage: 17:432/445 of query aligns to 14:417/427 of 2aa9A
- active site: K22 (= K25), S23 (= S26), D49 (= D52), N94 (= N96), P119 (≠ A121), R124 (= R126), D313 (= D324), E341 (= E352), H385 (= H399), R386 (= R400), K411 (≠ T426)
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: K22 (= K25), S23 (= S26), R27 (= R30), T97 (= T99), Q171 (≠ A172), Y200 (≠ T197), D313 (= D324), K340 (= K351)
1x8tA Epsps liganded with the (r)-phosphonate analog of the tetrahedral reaction intermediate (see paper)
29% identity, 93% coverage: 17:432/445 of query aligns to 14:417/427 of 1x8tA
- active site: K22 (= K25), S23 (= S26), D49 (= D52), N94 (= N96), P119 (≠ A121), R124 (= R126), D313 (= D324), E341 (= E352), H385 (= H399), R386 (= R400), K411 (≠ T426)
- binding [3r-[3a,4a,5b(r*)]]-5-(1-carboxy-1-phosphonoethoxy)-4-hydroxy-3-(phosphonooxy)-1-cyclohexene-1-carboxylic acid: K22 (= K25), S23 (= S26), R27 (= R30), T97 (= T99), S169 (≠ A170), S170 (= S171), Q171 (≠ A172), S197 (≠ A194), Y200 (≠ T197), D313 (= D324), N336 (≠ E347), K340 (= K351), R344 (= R355), H385 (= H399), R386 (= R400)
1x8rA Epsps liganded with the (s)-phosphonate analog of the tetrahedral reaction intermediate (see paper)
29% identity, 93% coverage: 17:432/445 of query aligns to 14:417/427 of 1x8rA
- active site: K22 (= K25), S23 (= S26), D49 (= D52), N94 (= N96), P119 (≠ A121), R124 (= R126), D313 (= D324), E341 (= E352), H385 (= H399), R386 (= R400), K411 (≠ T426)
- binding [3r-[3a,4a,5b(s*)]]-5-(1-carboxy-1-phosphonoethoxy)-4-hydroxy-3-(phosphonooxy)-1-cyclohexene-1-carboxylic acid: K22 (= K25), S23 (= S26), R27 (= R30), G96 (= G98), T97 (= T99), R124 (= R126), S169 (≠ A170), S170 (= S171), Q171 (≠ A172), S197 (≠ A194), Y200 (≠ T197), D313 (= D324), N336 (≠ E347), K340 (= K351), E341 (= E352), H385 (= H399), K411 (≠ T426)
1g6tA Structure of epsp synthase liganded with shikimate-3-phosphate (see paper)
29% identity, 93% coverage: 17:432/445 of query aligns to 14:417/427 of 1g6tA
- active site: K22 (= K25), S23 (= S26), D49 (= D52), N94 (= N96), P119 (≠ A121), R124 (= R126), D313 (= D324), E341 (= E352), H385 (= H399), R386 (= R400), K411 (≠ T426)
- binding phosphate ion: K22 (= K25), G96 (= G98), T97 (= T99), R124 (= R126), Q171 (≠ A172), E341 (= E352), K411 (≠ T426)
- binding shikimate-3-phosphate: K22 (= K25), S23 (= S26), R27 (= R30), T97 (= T99), S169 (≠ A170), S170 (= S171), Q171 (≠ A172), S197 (≠ A194), Y200 (≠ T197), D313 (= D324), N336 (≠ E347), K340 (= K351)
Query Sequence
>AZOBR_RS03090 FitnessBrowser__azobra:AZOBR_RS03090
MLQAKPLRSSSTGALAGTIRVPGDKSISHRSLMLGAVAVGETVIHGLLEGEDVLNTAAAM
RLLGAQAERGGDGVWRVRGVGLGGLGEPAQVLDMGNSGTAARLLMGLVASHPITCVFTGD
ASLNKRPMARVTGPLEQMGARFVGRSGGRLPLAVVGSDRTVPITYRLPVASAQVKSAVIL
CGLNTAGTTTVIEAEPTRDHTELMLRHFGATVTTERMEDGALAVSVVGQPELTGREIVVP
ADPSSAAFPAVAALLRPGSELLLPGVGMNPRRTGLYDTLVEMGANIAFENRRDEAGEPVA
DLRVKHGPLKGIVVPADRAPSMIDEYPILAAAAACAEGTTVMLGLKELRVKESDRLAMVA
DGLTKCGVKVEVGADDSLTVYGTGKPPQGGATVATAMDHRIAMSFLVLGMATSEPVQVDD
GAFIDTSFPGFVALMNGVGAKIAGA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory