SitesBLAST
Comparing AZOBR_RS03220 FitnessBrowser__azobra:AZOBR_RS03220 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5eksA Structure of 3-dehydroquinate synthase from acinetobacter baumannii in complex with NAD
46% identity, 95% coverage: 10:369/378 of query aligns to 2:346/355 of 5eksA
- active site: R120 (= R131), K142 (= K153), E184 (= E195), K226 (= K237), R237 (= R251), N241 (= N255), H244 (= H258), H248 (= H262), H261 (= H276)
- binding magnesium ion: E184 (= E195), H244 (= H258), H261 (= H276)
- binding nicotinamide-adenine-dinucleotide: N42 (≠ D52), V45 (= V55), D71 (≠ A82), E73 (= E84), K76 (= K87), G104 (= G115), G105 (= G116), V106 (= V117), D109 (= D120), T129 (= T140), T130 (= T141), D136 (= D147), S137 (= S148), K142 (= K153), T172 (= T183), L173 (= L184), E177 (= E188)
U3KRF2 3-dehydroquinate synthase, chloroplastic; EC 4.2.3.4 from Actinidia chinensis var. chinensis (Chinese soft-hair kiwi) (see paper)
46% identity, 95% coverage: 7:364/378 of query aligns to 81:431/445 of U3KRF2
3zokA Structure of 3-dehydroquinate synthase from actinidia chinensis in complex with NAD (see paper)
46% identity, 95% coverage: 7:364/378 of query aligns to 1:351/365 of 3zokA
- active site: R122 (= R131), K144 (= K153), E186 (= E195), K228 (= K237), E238 (= E247), R242 (= R251), N246 (= N255), H249 (= H258), H253 (= H262), H266 (= H276)
- binding glycine: K144 (= K153), K228 (= K237), R242 (= R251)
- binding nicotinamide-adenine-dinucleotide: T44 (≠ N54), V45 (= V55), D73 (≠ A82), E75 (= E84), K78 (= K87), G106 (= G115), G107 (= G116), V108 (= V117), D111 (= D120), T131 (= T140), T132 (= T141), M134 (≠ L143), D138 (= D147), S139 (= S148), K144 (= K153), K153 (= K162), T174 (= T183), L175 (= L184), E179 (= E188), H266 (= H276)
Q9KNV2 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
44% identity, 96% coverage: 10:373/378 of query aligns to 1:356/361 of Q9KNV2
3okfA 2.5 angstrom resolution crystal structure of 3-dehydroquinate synthase (arob) from vibrio cholerae
44% identity, 96% coverage: 10:373/378 of query aligns to 2:355/360 of 3okfA
- active site: R120 (= R131), K142 (= K153), E184 (= E195), K226 (= K237), R238 (= R251), N242 (= N255), H245 (= H258), H249 (= H262), H262 (= H276)
- binding nicotinamide-adenine-dinucleotide: N42 (≠ D52), L48 (≠ R58), D71 (≠ A82), E73 (= E84), K76 (= K87), G104 (= G115), G105 (= G116), V106 (= V117), D109 (= D120), T129 (= T140), T130 (= T141), L132 (= L143), D136 (= D147), T172 (= T183), L173 (= L184), E177 (= E188)
6llaB Crystal structure of providencia alcalifaciens 3-dehydroquinate synthase (dhqs) in complex with mg2+ and NAD (see paper)
43% identity, 97% coverage: 10:376/378 of query aligns to 2:362/363 of 6llaB
- active site: R121 (= R131), K143 (= K153), E185 (= E195), K227 (= K237), E237 (= E247), R242 (= R251), N246 (= N255), H249 (= H258), H253 (= H262), H266 (= H276)
- binding magnesium ion: E185 (= E195), H249 (= H258), H266 (= H276)
- binding nicotinamide-adenine-dinucleotide: L46 (≠ V55), D72 (≠ A82), E74 (= E84), K77 (= K87), G105 (= G115), G106 (= G116), V107 (= V117), D110 (= D120), T130 (= T140), T131 (= T141), L133 (= L143), D137 (= D147), K143 (= K153), T173 (= T183), L174 (= L184), E178 (= E188)
6lk2A Crystal structure of providencia alcalifaciens 3-dehydroquinate synthase (dhqs) in complex with mg2+, NAD and chlorogenic acid (see paper)
44% identity, 96% coverage: 10:370/378 of query aligns to 2:352/357 of 6lk2A
- active site: R121 (= R131), K143 (= K153), E185 (= E195), K227 (= K237), R238 (= R251), N242 (= N255), H245 (= H258), H249 (= H262), H262 (= H276)
- binding (1R,3R,4S,5R)-3-[3-[3,4-bis(oxidanyl)phenyl]propanoyloxy]-1,4,5-tris(oxidanyl)cyclohexane-1-carboxylic acid: D137 (= D147), E185 (= E195), K227 (= K237), R238 (= R251), N242 (= N255), H245 (= H258), T246 (= T259), H249 (= H262), H262 (= H276)
- binding magnesium ion: E185 (= E195), H245 (= H258), H262 (= H276)
- binding nicotinamide-adenine-dinucleotide: L46 (≠ V55), D72 (≠ A82), E74 (= E84), K77 (= K87), G105 (= G115), G106 (= G116), V107 (= V117), D110 (= D120), T130 (= T140), T131 (= T141), L133 (= L143), D137 (= D147), S138 (= S148), C170 (≠ T180), T173 (= T183), L174 (= L184), P175 (= P185), E178 (= E188)
Q5NFS1 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 from Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
42% identity, 92% coverage: 14:361/378 of query aligns to 4:345/359 of Q5NFS1
5hvnA 3.0 angstrom crystal structure of 3-dehydroquinate synthase (arob) from francisella tularensis in complex with NAD.
42% identity, 92% coverage: 14:361/378 of query aligns to 7:340/354 of 5hvnA
- active site: R123 (= R131), K145 (= K153), E187 (= E195), K228 (= K237), R239 (= R251), N243 (= N255), H246 (= H258), H250 (= H262), H263 (= H276)
- binding nicotinamide-adenine-dinucleotide: N45 (≠ D52), L51 (≠ R58), D73 (≠ A82), E75 (= E84), K78 (= K87), G107 (= G115), G108 (= G116), V109 (= V117), D112 (= D120), T132 (= T140), T133 (= T141), L135 (= L143), D139 (= D147), K145 (= K153), F172 (≠ T180), T175 (= T183), L176 (= L184), E180 (= E188)
P56081 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 from Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) (see paper)
37% identity, 92% coverage: 10:355/378 of query aligns to 1:322/343 of P56081
1dqsA Crystal structure of dehydroquinate synthase (dhqs) complexed with carbaphosphonate, NAD+ and zn2+ (see paper)
39% identity, 83% coverage: 48:361/378 of query aligns to 37:368/381 of 1dqsA
- active site: R127 (= R131), K149 (= K153), E191 (= E195), K240 (= K237), E250 (= E247), R254 (= R251), N258 (= N255), H261 (= H258), H265 (= H262), H277 (= H276)
- binding [1r-(1alpha,3beta,4alpha,5beta)]-5-(phosphonomethyl)-1,3,4-trihydroxycyclohexane-1-carboxylic acid: D143 (= D147), K149 (= K153), N159 (= N163), E191 (= E195), K240 (= K237), R254 (= R251), L257 (= L254), N258 (= N255), H261 (= H258), H265 (= H262), H277 (= H276), K346 (= K339)
- binding nicotinamide-adenine-dinucleotide: D41 (= D52), N43 (= N54), I44 (≠ V55), E78 (= E84), K81 (= K87), G111 (= G115), G112 (= G116), V113 (= V117), D116 (= D120), T136 (= T140), T137 (= T141), L139 (= L143), D143 (= D147), S144 (= S148), K158 (= K162), T179 (= T183), P181 (= P185), E184 (= E188), H277 (= H276)
- binding zinc ion: E191 (= E195), H261 (= H258), H277 (= H276)
P07547 Pentafunctional AROM polypeptide; EC 4.2.3.4; EC 2.5.1.19; EC 2.7.1.71; EC 4.2.1.10; EC 1.1.1.25 from Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans) (see 2 papers)
39% identity, 83% coverage: 48:361/378 of query aligns to 40:378/1583 of P07547
1nvbB Crystal structure of 3-dehydroquinate synthase (dhqs) in complex with zn2+ and carbaphosphonate (see paper)
38% identity, 83% coverage: 48:361/378 of query aligns to 38:376/391 of 1nvbB
- active site: R128 (= R131), K150 (= K153), E192 (= E195), K248 (= K237), E258 (= E247), R262 (= R251), N266 (= N255), H269 (= H258), H273 (= H262), H285 (= H276)
- binding [1r-(1alpha,3beta,4alpha,5beta)]-5-(phosphonomethyl)-1,3,4-trihydroxycyclohexane-1-carboxylic acid: D144 (= D147), K150 (= K153), N160 (= N163), E192 (= E195), K248 (= K237), R262 (= R251), L265 (= L254), N266 (= N255), H269 (= H258), H273 (= H262), K354 (= K339)
- binding zinc ion: E192 (= E195), H269 (= H258), H285 (= H276)
6hqvA Pentafunctional arom complex from chaetomium thermophilum (see paper)
39% identity, 87% coverage: 48:376/378 of query aligns to 38:388/1555 of 6hqvA
- active site: R123 (= R131), K145 (= K153), E187 (= E195), K243 (= K237), E253 (= E247), R257 (= R251), N261 (= N255), H264 (= H258), H268 (= H262), H280 (= H276)
- binding glutamic acid: D139 (= D147), K145 (= K153), E187 (= E195), K243 (= K237), R257 (= R251), H264 (= H258), H280 (= H276)
- binding nicotinamide-adenine-dinucleotide: D42 (= D52), N44 (= N54), L45 (≠ V55), E76 (= E84), K79 (= K87), G107 (= G115), G108 (= G116), V109 (= V117), D112 (= D120), T132 (= T140), T133 (= T141), L135 (= L143), D139 (= D147), S140 (= S148), K145 (= K153), K154 (= K162), T175 (= T183), L176 (= L184), P177 (= P185), E180 (= E188), H280 (= H276)
- binding zinc ion: E187 (= E195), H264 (= H258), H280 (= H276)
Sites not aligning to the query:
- binding (4S,5R)-4,5-dihydroxy-3-oxocyclohex-1-ene-1-carboxylic acid: 1060, 1062, 1181, 1224, 1232, 1242, 1243
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: 413, 562, 563, 874, 923, 924, 979, 1277, 1279, 1323, 1327, 1348, 1368, 1526
3clhA Crystal structure of 3-dehydroquinate synthase (dhqs)from helicobacter pylori (see paper)
39% identity, 79% coverage: 17:314/378 of query aligns to 5:274/308 of 3clhA
- active site: R107 (= R131), K129 (= K153), E171 (= E195), K207 (= K237), R212 (= R251), N216 (= N255), H219 (= H258), H223 (= H262), H236 (= H276)
- binding nicotinamide-adenine-dinucleotide: I33 (≠ N54), V34 (= V55), H38 (= H59), S58 (≠ A82), E60 (= E84), K63 (= K87), G91 (= G115), G92 (= G116), V93 (= V117), D96 (= D120), T116 (= T140), T117 (= T141), L119 (= L143), D123 (= D147), A124 (≠ S148), K129 (= K153), N139 (= N163), T159 (= T183), L160 (= L184), E164 (= E188)
Q6GGU4 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 from Staphylococcus aureus (strain MRSA252) (see paper)
34% identity, 94% coverage: 20:373/378 of query aligns to 10:347/354 of Q6GGU4
1xagA Crystal structure of staphlyococcus aureus 3-dehydroquinate synthase (dhqs) in complex with zn2+, NAD+ and carbaphosphonate (see paper)
38% identity, 80% coverage: 73:373/378 of query aligns to 57:347/353 of 1xagA
- active site: R115 (= R131), K136 (= K153), E178 (= E195), K221 (= K237), E231 (= E247), R235 (= R251), N239 (= N255), H242 (= H258), H246 (= H262), H256 (= H276)
- binding [1r-(1alpha,3beta,4alpha,5beta)]-5-(phosphonomethyl)-1,3,4-trihydroxycyclohexane-1-carboxylic acid: K136 (= K153), N146 (= N163), E178 (= E195), K221 (= K237), R235 (= R251), L238 (= L254), N239 (= N255), H242 (= H258), H246 (= H262), K314 (= K339)
- binding nicotinamide-adenine-dinucleotide: E68 (= E84), K71 (= K87), G99 (= G115), G100 (= G116), A101 (≠ V117), D104 (= D120), T124 (= T140), T125 (= T141), L127 (= L143), D130 (= D147), S131 (= S148), K136 (= K153), K145 (= K162), T166 (= T183), L167 (= L184), Q171 (≠ E188), H256 (= H276)
- binding zinc ion: E178 (= E195), H242 (= H258), H256 (= H276)
Sites not aligning to the query:
6c5cA Crystal structure of the 3-dehydroquinate synthase (dhqs) domain of aro1 from candida albicans sc5314 in complex with nadh (see paper)
39% identity, 82% coverage: 48:358/378 of query aligns to 41:368/385 of 6c5cA
- active site: R130 (= R131), K152 (= K153), E194 (= E195), K246 (= K237), E254 (= E247), R258 (= R251), N262 (= N255), H265 (= H258), H269 (= H262), H281 (= H276)
- binding nicotinamide-adenine-dinucleotide: D45 (= D52), N47 (= N54), M48 (≠ V55), E83 (= E84), K86 (= K87), G114 (= G115), G115 (= G116), V116 (= V117), D119 (= D120), T139 (= T140), T140 (= T141), D146 (= D147), S147 (= S148), F179 (≠ T180), T182 (= T183), L183 (= L184), Q187 (≠ E188)
1nvaA Crystal structure of 3-dehydroquinate synthase (dhqs) in complex with zn2+ and adp (see paper)
37% identity, 83% coverage: 48:361/378 of query aligns to 37:366/380 of 1nvaA
- active site: R127 (= R131), K149 (= K153), E191 (= E195), K247 (= K237), R257 (= R251), N261 (= N255), H264 (= H258), H268 (= H262), H280 (= H276)
- binding adenosine-5'-diphosphate: D41 (= D52), N43 (= N54), G111 (= G115), G112 (= G116), T136 (= T140), T137 (= T141), F176 (≠ T180), T179 (= T183), L180 (= L184)
- binding zinc ion: E191 (= E195), H264 (= H258), H280 (= H276)
P9WPX9 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
40% identity, 77% coverage: 78:368/378 of query aligns to 69:352/362 of P9WPX9
Sites not aligning to the query:
Query Sequence
>AZOBR_RS03220 FitnessBrowser__azobra:AZOBR_RS03220
MTSPDTPTAIDTVRLDLGPRSYDILVGDRVLDGAGPRIAAITRGKAPIVVTDENVAPRHL
PTLERTLRDAGIEPTQAIVLPAGEKTKDIAHFERLMDAVLARGIERSAVLLALGGGVIGD
ITGFAAASALRGIDFIQVPTTLLSQVDSSVGGKTGINSPHGKNLIGAFHQPRLVIADTAT
LDTLPRREVLAGYAEVVKYGLIRLPGFFAWLEENGERVVAGDSDARRHAVTESCRAKAAI
VGVDERESGDRALLNLGHTFGHALEAATGFGSRLLHGEAVSIGMVLAFDLSVRLGLCPAA
DAEKARAHLARVGLPVRPTDVPGVEWDIDGLILSMAKDKKVKDGRITFVLVRALGDAFTQ
RDVDPAVVRALLEDAVAR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory