Comparing AZOBR_RS03245 FitnessBrowser__azobra:AZOBR_RS03245 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
3cuxA Atomic resolution structures of escherichia coli and bacillis anthracis malate synthase a: comparison with isoform g and implications for structure based drug design (see paper)
62% identity, 95% coverage: 21:527/534 of query aligns to 13:499/501 of 3cuxA
3cv1A Atomic resolution structures of escherichia coli and bacillis anthracis malate synthase a: comparison with isoform g and implications for structure based drug design (see paper)
55% identity, 99% coverage: 2:531/534 of query aligns to 1:529/529 of 3cv1A
3cuzA Atomic resolution structures of escherichia coli and bacillis anthracis malate synthase a: comparison with isoform g and implications for structure based drug design (see paper)
55% identity, 99% coverage: 2:531/534 of query aligns to 1:529/529 of 3cuzA
3cv2A Atomic resolution structures of escherichia coli and bacillis anthracis malate synthase a: comparison with isoform g and implications for structure based drug design (see paper)
56% identity, 96% coverage: 19:531/534 of query aligns to 13:524/524 of 3cv2A
P30952 Malate synthase 1; EC 2.3.3.9 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
51% identity, 98% coverage: 13:534/534 of query aligns to 23:546/554 of P30952
Sites not aligning to the query:
6axeA Crystal structure of a malate synthase g from mycobacterium marinum bound to acetyl coa
26% identity, 53% coverage: 178:461/534 of query aligns to 357:653/729 of 6axeA
Sites not aligning to the query:
>AZOBR_RS03245 FitnessBrowser__azobra:AZOBR_RS03245
MATTISGLEILGPITPGVETILTPEALAFLAELEGRFGSERLRLLDVRTKRRALIDQGHR
PDFLPETRAIREADWTIAPLPHDLLDRRVEITGPVDRKMVINALNSGAKVFMADFEDSSC
PSWANLIEGQANLRDAVRRTIAFDDPVSGKKYRLNDKTAVLKVRPRGWHLAEKHVRFDGE
PVSGALFDFALYAFHNAQELLARGSGPYFYLPKLESHFEARLWNEVFSVAEDYLKIPHGS
IKATVLVETILAAFEMDEILYELRDHSAGLNCGRWDYIFSFIKTFRNDPAAVLPDRAEVT
MATPFLQSYSLLAVKTCHRRGAPAIGGMAAYIPVKDDPAANETAFSKVRADKEREVSNGH
DGTWVAHPGLVPVAREVFDAYMRKPNQIDRKRADVSVTAADLLAVPEGPKTERGLRNNVA
VAIGYLEAWLRGIGCVPLFNLMEDAATAEISRTQLWQWVHHRATLDDGRPVTMELVDETI
AEELAAWKARVGDRAFDHGLYEEAAVMLRDLVERDDFVDFLTLPAYDRIVAQGA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory