Comparing AZOBR_RS03285 FitnessBrowser__azobra:AZOBR_RS03285 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2bufC Arginine feed-back inhibitable acetylglutamate kinase (see paper)
56% identity, 98% coverage: 5:296/299 of query aligns to 3:294/298 of 2bufC
Q9HTN2 Acetylglutamate kinase; N-acetyl-L-glutamate 5-phosphotransferase; NAG kinase; NAGK; EC 2.7.2.8 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see 2 papers)
56% identity, 98% coverage: 5:296/299 of query aligns to 4:295/301 of Q9HTN2
Sites not aligning to the query:
2bufA Arginine feed-back inhibitable acetylglutamate kinase (see paper)
55% identity, 98% coverage: 5:296/299 of query aligns to 3:286/292 of 2bufA
2bufK Arginine feed-back inhibitable acetylglutamate kinase (see paper)
53% identity, 98% coverage: 5:296/299 of query aligns to 3:271/273 of 2bufK
2v5hB Controlling the storage of nitrogen as arginine: the complex of pii and acetylglutamate kinase from synechococcus elongatus pcc 7942 (see paper)
52% identity, 95% coverage: 12:296/299 of query aligns to 6:281/289 of 2v5hB
2btyA Acetylglutamate kinase from thermotoga maritima complexed with its inhibitor arginine (see paper)
50% identity, 95% coverage: 14:296/299 of query aligns to 7:277/282 of 2btyA
Q9X2A4 Acetylglutamate kinase; N-acetyl-L-glutamate 5-phosphotransferase; NAG kinase; NAGK; EC 2.7.2.8 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
50% identity, 95% coverage: 14:296/299 of query aligns to 7:277/282 of Q9X2A4
Q9SCL7 Acetylglutamate kinase, chloroplastic; N-acetyl-L-glutamate 5-phosphotransferase; NAG kinase; AtNAGK; EC 2.7.2.8 from Arabidopsis thaliana (Mouse-ear cress) (see 3 papers)
48% identity, 95% coverage: 12:296/299 of query aligns to 69:345/347 of Q9SCL7
Sites not aligning to the query:
4usjB N-acetylglutamate kinase from arabidopsis thaliana in complex with pii from chlamydomonas reinhardtii (see paper)
48% identity, 95% coverage: 12:296/299 of query aligns to 3:279/281 of 4usjB
2rd5B Structural basis for the regulation of n-acetylglutamate kinase by pii in arabidopsis thaliana (see paper)
48% identity, 95% coverage: 12:296/299 of query aligns to 5:281/283 of 2rd5B
7nlwA Crystal structure of mycobacterium tuberculosis argb in complex with 2-(5-methoxy-1h-indol-3-yl)acetonitrile
44% identity, 96% coverage: 12:298/299 of query aligns to 9:290/290 of 7nlwA
7nlpA Crystal structure of mycobacterium tuberculosis argb in complex with l-canavanine
44% identity, 96% coverage: 12:298/299 of query aligns to 10:291/292 of 7nlpA
7nnbA Crystal structure of mycobacterium tuberculosis argb in complex with 2,8-bis(trifluoromethyl)quinolin-4-ol.
44% identity, 96% coverage: 12:298/299 of query aligns to 9:290/291 of 7nnbA
7nn8A Crystal structure of mycobacterium tuberculosis argb in complex with 1h-indole-3-carbonitrile.
44% identity, 96% coverage: 12:298/299 of query aligns to 9:290/291 of 7nn8A
7nm0A Crystal structure of mycobacterium tuberculosis argb in complex with 1-(2,6-dihydroxyphenyl)ethan-1-one.
44% identity, 96% coverage: 12:298/299 of query aligns to 9:290/291 of 7nm0A
7nlzA Crystal structure of mycobacterium tuberculosis argb in complex with 5-methoxy-6-(trifluoromethyl)indole.
44% identity, 96% coverage: 12:298/299 of query aligns to 9:290/291 of 7nlzA
7nltA Crystal structure of mycobacterium tuberculosis argb in complex with 4-(4-methylpiperazin-1-yl)benzoic acid
44% identity, 96% coverage: 12:298/299 of query aligns to 9:290/291 of 7nltA
7nlrA Crystal structure of mycobacterium tuberculosis argb in complex with 2-phenyl-1h-imidazole
44% identity, 96% coverage: 12:298/299 of query aligns to 9:290/291 of 7nlrA
7nloA Crystal structure of mycobacterium tuberculosis argb in complex with l-arginine
44% identity, 96% coverage: 12:298/299 of query aligns to 7:288/289 of 7nloA
7nlyA Crystal structure of mycobacterium tuberculosis argb in complex with 2-chlorobenzimidazole.
44% identity, 96% coverage: 12:298/299 of query aligns to 11:292/293 of 7nlyA
>AZOBR_RS03285 FitnessBrowser__azobra:AZOBR_RS03285
VQNTTRDEWLAKARTLSEALPYMRRYAGRTFVIKYGGHAMGDDSLAEKFARDIVLLKQVG
INPVVVHGGGPQIGQMLQRLAIKSSFIDGLRVTDKETVEVVEMVLAGSINKQIVAAINNA
GGRAVGLSGKDGSLITARKLRRTQRDPDSNIEKVLDLGFVGEPYQVNPQIITSLAQSDII
PVIAPIGFDRNGDTYNINADTAAGAVASALGATRFFLLTDVAGVLDKNKELVPRMSLDQA
RAAIADGTATGGMIPKIETCIDAVEQGVDAAVILDGRVPHALLLEIFTEGGAGTLIGRE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory