Comparing AZOBR_RS03470 FitnessBrowser__azobra:AZOBR_RS03470 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7t1qA Crystal structure of the succinyl-diaminopimelate desuccinylase (dape) from acinetobacter baumannii in complex with succinic acid
46% identity, 93% coverage: 26:393/397 of query aligns to 16:375/377 of 7t1qA
P44514 Succinyl-diaminopimelate desuccinylase; SDAP desuccinylase; N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase; EC 3.5.1.18 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 3 papers)
43% identity, 95% coverage: 16:394/397 of query aligns to 6:376/377 of P44514
5vo3A Crystal structure of dape in complex with the products (succinic acid and diaminopimelic acid) (see paper)
43% identity, 95% coverage: 16:394/397 of query aligns to 10:380/380 of 5vo3A
4o23A Crystal structure of mono-zinc form of succinyl diaminopimelate desuccinylase from neisseria meningitidis mc58 (see paper)
44% identity, 94% coverage: 16:389/397 of query aligns to 6:371/376 of 4o23A
4pqaA Crystal structure of succinyl-diaminopimelate desuccinylase from neisseria meningitidis mc58 in complex with the inhibitor captopril (see paper)
44% identity, 94% coverage: 16:389/397 of query aligns to 6:371/375 of 4pqaA
7lgpB Dape enzyme from shigella flexneri
41% identity, 96% coverage: 13:392/397 of query aligns to 5:375/377 of 7lgpB
4h2kA Crystal structure of the catalytic domain of succinyl-diaminopimelate desuccinylase from haemophilus influenzae (see paper)
48% identity, 46% coverage: 16:199/397 of query aligns to 8:182/258 of 4h2kA
Sites not aligning to the query:
4op4B Crystal structure of the catalytic domain of dape protein from v.Cholerea in the zn bound form (see paper)
45% identity, 48% coverage: 16:206/397 of query aligns to 6:185/265 of 4op4B
Sites not aligning to the query:
7uoiA Crystallographic structure of dape from enterococcus faecium
29% identity, 96% coverage: 9:389/397 of query aligns to 4:378/383 of 7uoiA
3pfoA Crystal structure of a putative acetylornithine deacetylase (rpa2325) from rhodopseudomonas palustris cga009 at 1.90 a resolution
27% identity, 78% coverage: 73:382/397 of query aligns to 95:410/426 of 3pfoA
7rsfA Acetylornithine deacetylase from escherichia coli
26% identity, 79% coverage: 59:372/397 of query aligns to 54:357/380 of 7rsfA
Q8C165 N-fatty-acyl-amino acid synthase/hydrolase PM20D1; Peptidase M20 domain-containing protein 1; PM20D1; EC 3.5.1.114; EC 3.5.1.14 from Mus musculus (Mouse) (see paper)
30% identity, 43% coverage: 49:217/397 of query aligns to 90:262/503 of Q8C165
Sites not aligning to the query:
1cg2A Carboxypeptidase g2 (see paper)
26% identity, 70% coverage: 17:294/397 of query aligns to 17:280/389 of 1cg2A
Sites not aligning to the query:
P06621 Carboxypeptidase G2; CPDG2; Folate hydrolase G2; Glutamate carboxypeptidase; Pteroylmonoglutamic acid hydrolase G2; Glucarpidase; EC 3.4.17.11 from Pseudomonas sp. (strain RS-16) (see paper)
26% identity, 70% coverage: 17:294/397 of query aligns to 42:305/415 of P06621
Sites not aligning to the query:
Q96KP4 Cytosolic non-specific dipeptidase; CNDP dipeptidase 2; Glutamate carboxypeptidase-like protein 1; Peptidase A; Threonyl dipeptidase; EC 3.4.13.18 from Homo sapiens (Human)
34% identity, 22% coverage: 66:154/397 of query aligns to 81:167/475 of Q96KP4
Sites not aligning to the query:
P45494 Beta-Ala-Xaa dipeptidase; Beta-Ala-His dipeptidase; Peptidase V; EC 3.4.13.- from Lactobacillus delbrueckii subsp. lactis (see paper)
43% identity, 19% coverage: 81:154/397 of query aligns to 86:154/470 of P45494
Sites not aligning to the query:
1lfwA Crystal structure of pepv (see paper)
43% identity, 19% coverage: 81:154/397 of query aligns to 86:154/468 of 1lfwA
Sites not aligning to the query:
Q96KN2 Beta-Ala-His dipeptidase; CNDP dipeptidase 1; Carnosine dipeptidase 1; Glutamate carboxypeptidase-like protein 2; Serum carnosinase; EC 3.4.13.20 from Homo sapiens (Human) (see 4 papers)
40% identity, 20% coverage: 78:155/397 of query aligns to 128:201/507 of Q96KN2
Sites not aligning to the query:
3dljA Crystal structure of human carnosine dipeptidase 1
40% identity, 20% coverage: 78:155/397 of query aligns to 97:170/471 of 3dljA
Sites not aligning to the query:
2pokA Crystal structure of a m20 family metallo peptidase from streptococcus pneumoniae
28% identity, 47% coverage: 18:202/397 of query aligns to 26:206/458 of 2pokA
Sites not aligning to the query:
>AZOBR_RS03470 FitnessBrowser__azobra:AZOBR_RS03470
MSTAAAAPSFDPCDPVAVAQALIRCPSVTPEDGGALGVLEAALAPLGFVCHRLRFEEEGT
APVDNLYARLGTEGPNFCFAGHTDVVPPGELKGWSIDPFAAEIHNGRLYGRGAVDMKGAI
AAFVAAAARHVKAVKETGDAPKGSISLLITGDEEGVAINGTRKVLDWLQAKGEKLDACVV
GEPTNPKALGDMIKIGRRGSMTAFLTVHGAQGHVAYPHLADNPLPRLARMLTAITAEPLD
AGTPHFQPSNLELTTIDVGNPAHNVIPAQGKATLNIRFNDLHTADTLLAWLRERLDGVGG
SYELDHFVSGDSFLTPPGPLTELVADAAERVTGRRPEYSTTGGTSDARFIKNFCPVVEFG
LVGQTMHKVDEHTALDDLTRLTDIYGEVLRNVFDRIG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory